KEGG   Pseudomonas putida NBRC 14164: PP4_04330Help
Entry
PP4_04330         CDS       T02707                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
ppun  Pseudomonas putida NBRC 14164
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PP4_04330 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: BAN52286
Position
complement(510816..511196)
Genome map
AA seq 126 aa AA seqDB search
MSDPRYLIDVSVVTRYLKEQSDPENSRFAFAYTITVHNSGSLKAKLLSRHWLITNGDGEV
EEVRGSGVVGQQPNIDPGQSHTYSSGAVITTRVGTMQGSYQMFAEDGKRFDAEIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctcgctatctgatcgacgtcagcgtcgtgacccgctacctgaaagaacaa
tccgaccccgaaaacagtcgtttcgccttcgcctacaccatcaccgtgcacaacagcggc
tcgctcaaggccaagctgctgtcacgccactggctgatcaccaatggtgacggcgaggtc
gaggaagtgcgtggctccggcgtggtcggccaacaacccaacatcgatccgggccagagc
cacacctatagcagcggtgcggtaatcaccacccgtgtgggtaccatgcagggcagttac
cagatgttcgccgaagacggtaagcgcttcgacgccgagatcgcccccttccgcctcgcg
gtgcccggggcactgcactga

DBGET integrated database retrieval system