KEGG   Pseudomonas putida NBRC 14164: PP4_06240Help
Entry
PP4_06240         CDS       T02707                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PP4_06240
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PP4_06240
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PP4_06240
    1.1.1.-  
     PP4_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAN52477
Position
complement(728793..729881)
Genome map
AA seq 362 aa AA seqDB search
MNDLSHNHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCGICGSDLHEYVAGPVFI
PVEAPHPLTGIQGQCILGHEFCGQIAKLGEGVEGFAVGDPVAADACQHCGTCYYCTHGLY
NICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAGALIEPLAVGMHAVKKAGSLL
GQTVVVVGAGTIGLCTIMCAKAAGAAKVIALEMSSARKAKAKEVGASVVLDPSQCDALEE
IRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKCVLVGIFEEASEFNFFELVSTEKQV
LGALAYNGEFADVIAFIADGRLDIRPLVTGRIGLEQIVELGFEELVNNKEENVKIIVSPG
VR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacctgagccacaaccatatgcgcgccgccgtctggcatggccgcaacgacatt
cgcgtcgaacaggtgcctttgccagccgaccctgcgcccggctgggtacagatcaaggtg
gactggtgcggcatctgcggctccgacctgcacgaatacgtcgccggcccggtattcatc
ccggtggaggcgcctcacccgctgaccggcatccagggccagtgcatcctcggccacgaa
ttctgcgggcagatcgccaagctcggtgaaggtgtggaagggttcgcggtgggcgacccc
gtggcggctgacgcctgccagcattgcggcacttgctattactgcacccacggcctgtac
aacatctgcgaacgcctggccttcaccggcctgatgaacaacggcgccttcgccgaactg
gtcaacgtgcctgccaatctgttgtaccggctgccgcaaggcttccctgcagaagcaggg
gcactgatcgaaccgctggcggtgggcatgcacgcggtgaaaaaggccggcagcctgctc
gggcaaactgttgtggtggttggcgccggcaccatcggcctgtgcaccatcatgtgcgcc
aaagccgcaggggcggcgaaggtaatcgccctggagatgtcttcggcgcgtaaagccaag
gcgaaggaagtgggtgcaagcgtggtgctggaccccagccagtgcgacgccctggaggaa
atccgcgcgctgaccgccgggctgggggcggatgtgagctttgagtgcatcggcaacaag
cacacggccaagctggccatcgacaccatccgcaaggcaggtaaatgtgtgctggtgggc
attttcgaagaagccagcgagttcaacttcttcgagctggtgtccaccgagaagcaggtg
ctgggagcgttggcgtacaacggcgagtttgccgatgtgattgccttcatcgcagatggc
aggctggacatccgcccgctggtgaccgggcggatcgggctggagcagattgtcgagctg
ggcttcgaggaactggtgaacaacaaagaggagaacgtgaagatcatcgtttcaccgggc
gtgcgctga

DBGET integrated database retrieval system