KEGG   Pseudomonas putida NBRC 14164: PP4_24420Help
Entry
PP4_24420         CDS       T02707                                 

Definition
(GenBank) putative type VI secretion system protein
  KO
K11902  type VI secretion system protein ImpA
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PP4_24420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppun02044]
    PP4_24420
Secretion system [BR:ppun02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP4_24420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N ATP-grasp_5 HHH_6 DUF2514
Motif
Other DBs
NCBI-ProteinID: BAN54295
Position
complement(2779356..2780441)
Genome map
AA seq 361 aa AA seqDB search
MPEILNDLSLATLAAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTANWE
QVIDLSAQGLAEQSKDLMLAAWLSEGLAQREHFKGITFGLELTERVLDAFWETLYPTLED
GLDERAARLSWLKTTLSDIAGGLPITQGQNFGVLRYDESRHVENLALQNPKAMQTALNEG
KINAEIFQRSVALSDTDHLRAKALEIATSLNACKRLQATVDRLFEREAPSFASLADMLSR
ASQLAEKLLKDRGVELHPTLLEEQEPEAVTANPQSAGEQMDTRPPATVPAAMRTTPLTRD
EAFTMLAGIAQYFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDNNVVDNIRDVLGT
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaattctcaatgacctttcgctggccacgctggccgcccccatcgagggtggc
agtggcgaagacttgagcttctctgccttgttcgaccagatcaaggaggcacgccgggcc
gaccctgactacctgacccagggcgactggcaaaccgacctgaagactgccaactgggag
caggtgatcgacctgtcggcgcaagggctggcggagcagagcaaagatttgatgctggcg
gcctggctcagtgaagggctggctcagcgcgagcacttcaaaggtatcacctttggcctg
gagctgaccgaacgggtgctggacgcgttttgggagacgctgtacccaaccctggaagac
ggcctggatgagcgcgcagcgcggctgtcctggctcaagaccacgctcagcgacattgcc
ggtggtttgcccattacccaagggcagaattttggcgtgttgcgctatgacgaatcacgc
cacgtagaaaacctcgccttgcaaaaccccaaggcaatgcagacagcgcttaacgaaggc
aagatcaacgctgagattttccagcgctcggtagcacttagcgacaccgatcacctgcgc
gccaaggccttggagattgccaccagtctcaatgcatgcaagcgcctgcaggctacggta
gaccgcctgttcgagcgcgaggcacccagctttgccagccttgccgacatgctctcgcgt
gcaagccagctggcggagaaactgctcaaggaccgcggtgtcgagctgcaccccaccctc
ctcgaggagcaggagccagaggccgtcacggccaacccccaatcagcaggtgaacaaatg
gatacacgcccaccggcgactgtgccagccgccatgcgcaccacgccgctgacccgcgat
gaggcgttcaccatgcttgcgggcattgcccagtacttcaagcagagcgaaccgcaaagc
ccggtaccctacctgatagaacgtgcaataaagtggggcaacatgccgctggaaggctgg
ctcagtgatgtgatcaaagacaacaatgtcgtggacaacatccgtgatgtgctgggcacc
cgctag

DBGET integrated database retrieval system