KEGG   Pseudomonas putida NBRC 14164: PP4_24460
Entry
PP4_24460         CDS       T02707                                 

Definition
(GenBank) putative type VI secretion system protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun02025  Biofilm formation - Pseudomonas aeruginosa
ppun03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PP4_24460
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PP4_24460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppun02044]
    PP4_24460
Secretion system [BR:ppun02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP4_24460
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C MMR_HSR1 AAA_16
Other DBs
NCBI-ProteinID: BAN54299
Position
complement(2784597..2788394)
AA seq 1265 aa
MKTLLRLLKSFWVLLPLLWLASLLICWLAAPLVPWLRHHVPEALAIISACFLLVIVLRQY
QRIRAEHNLENLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSD
LPWYLVVGMSAAGKTSLLTHSGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRD
DQSASEFSAFLRMLRKQRGKAAINGLVLVVSLPELLAANSDERNALANQLVARVEEYAEC
LGANPPIYLMLSKTDQLPGFSQAFEGLDLHERQQPLGMTFGLSEIRNNGLHAVLQTRLKN
LQGRIRQHVDAQMIALGAEADSTLLNFPQYFAALSEVLEPFLDHFTQGHRGGNPLLLRGL
YFTSALQTGQQLGQVYEDVIADEFALQAAYDERVESTTKAVGNRSYFITDTFRRVIFPDR
DLTLYQSRQGSQAAFSPLLLGLAVATGVVFIGWQALSFINNRQWLEGLRGQLAQIEQAQE
REQLLAAGKGLEVLREQMSIVEAHRLQGVPLQLAAGLYHGEAIHQVSSTAYLAQLRSQAL
EPIARSLQVQMRAFNTFANGINQALEFTPAPQPKKRSGKAIAAAVAAKAAAVDTRLGAYA
AKVNLATASDAAELSATTGGLSLSEEMLGRLNEQQVASIIEAYNTLKLYLLLTEPQAHPD
PAFVSASLPQAWAGAAAEGSPADTRVIEENVPLYVQLLEQGQAPALPRNEQLINETRQNL
KAFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYSSAGVPAIYTRQGWDTF
VKPELIKLVSGNLRNESDWVLDGEGGDAVVQKANFVREFMARYKRDYTQAWYKMVSSVGM
RHFADLASATDQLGLLSDVQNSPVKNLLAAVNDNTRWDLPINHAIPSPGAARDDGFWSKV
TGLFDADHALPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKL
KVRMNNIQRSQDVGKGSKQLISETLEGQPSEVTTVRNYVEGSVDTSQDGLSRSLQGLFSL
PIQYAWATLRDPAGQQIAKAWAQQIAKPWEQVMAHRYPIAGSSNNEASVKDLQRFVDPQS
GLLPAFKRNEIGNLAGGEGLGVGDSKGPALVNPGMLNSIDKASSVGQVIASLSDRDNGFE
IMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPATSNAPGARLDVVTLSGARLTVFD
FPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGNVKALSALN
DRGAQ
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaaaacattactgcgtctgttgaaaagtttctgggtgctgctgccattgctgtggctg
gccagcctgttgatttgctggctggccgcgccgctggtgccgtggctgcgtcatcacgtg
ccggaagcgctggcaataatcagtgcctgcttcctgctggtgattgtgctgcgccaatat
cagcgcatccgtgccgagcacaacctcgagaacctgctgcaaatcgaggtcgaccgctcg
tggaatgccaccggcgagttccgtgaccagcaggtactgcgcgagcgcctgaagcacgcc
atcgccatgctgcgcaccgaccgctctgccggaggcggcggcaaggccgcgctgtccgat
ctgccctggtacctggtggttggcatgtcggctgcgggcaagacttcgctgctgacccat
tccggcttgtcggccagcattgccacggccaacgacagtgaaagcggtacccagcactgc
gactggtacttcagccccgatgccgtgatgatcgataccgccgggcgctacctgcgcgac
gaccagtcggccagcgagttctcggcctttctgcggatgctgcgcaagcagcgcggcaag
gcggcgatcaatggcctggtcctggtggtaagcctgcccgagttactggcggccaacagc
gatgagcgcaatgccttggccaaccagttggtggcacgggtcgaagagtacgccgaatgc
ctgggcgccaacccgccgatctacctgatgctgagcaagaccgaccagttgccggggttc
agccaggcatttgagggcctcgacctgcacgaacgccagcagccgctgggcatgaccttt
ggcctgtcggaaatccgcaacaatggcctgcacgccgtgctgcaaacgcggctgaaaaac
ctgcaaggccgtattcgccagcacgtcgacgcacagatgatcgccctcggtgccgaagcc
gatagcaccctgttgaacttcccgcagtatttcgccgccctcagtgaagtgctcgaaccc
ttccttgaccacttcacccagggccatcgcggtggtaatccgctattgctgcggggcctg
tacttcaccagtgcgctgcagaccgggcagcagctggggcaggtttatgaagacgtcatc
gccgatgagttcgccctccaggcggcctacgacgagcgcgtcgaaagcaccaccaaggcc
gtcggtaaccgcagctacttcatcaccgacaccttccgccgggtgatcttcccggaccgc
gacctgactttgtaccagtcgcgccagggcagccaggccgcgttcagccctctgttacta
ggcctggccgtcgccacgggggttgtgttcatcggctggcaggcactgtcgttcatcaac
aaccggcaatggctcgaaggcctgcgcgggcaactggcgcagatcgaacaagcgcaggag
cgcgagcaactgctggctgccggcaaggggttggaggtgctgcgcgaacagatgtcgatc
gtcgaagcccatcgcctgcaaggtgtcccgctgcaattggctgccggcctttaccatggc
gaagcgatccaccaggtgagcagcaccgcttacctggcgcaattgcgcagccaggcgctg
gagccgatcgcccgtagcctgcaagtgcagatgcgcgcgttcaacacctttgccaacggc
atcaaccaggccctggagttcaccccggcgccgcagcctaaaaaacgcagcggcaaggcg
atcgccgctgccgtggccgccaaggccgccgcagtcgacacccgcctgggcgcctacgcc
gccaaggtcaacctggccacggccagcgatgctgccgagttgtctgccactaccggcggc
ctgtcgttgtccgaagaaatgcttggccggctgaacgaacaacaggtggcctcgatcatc
gaggcctacaacacactcaaactgtacctgctgctgaccgaaccccaggctcacccggac
ccggccttcgtctctgcaagcctgccccaggcctgggccggcgcagcagctgaagggtcc
ccggccgacacccgggtaatcgaggaaaacgtgccgctgtacgtgcagctgctggagcaa
ggccaagcgcccgcgctgccgcgcaacgagcagttgatcaatgaaacccggcagaacctc
aaggcattcatgatctccagctccctggtcgatcgcgaatacctgcgcctgcaacttgag
tcgagccgccagttcccggcgctcagcctcaacgacctggtcccgcaaccgggccgcgcg
ctgctgtacagctccgctggggtaccggcaatctacacgcgccagggctgggacaccttc
gtcaagcccgagctgatcaagctggtgtcgggcaacctgcgcaacgagtcggactgggtg
ctggacggcgaaggcggcgatgccgtcgtgcaaaaagccaacttcgtgcgtgagttcatg
gcccgctacaagcgcgactacacccaagcctggtacaagatggtcagcagcgtcggcatg
cgccacttcgccgacctggcctcggccaccgatcaactgggcctgctcagcgacgtgcag
aactcgccggtgaagaacctgctggctgcggtcaatgacaatacccgctgggacctgccg
atcaaccatgctatcccgagcccaggtgccgcccgcgatgacggcttctggagcaaggtc
accggcctgttcgatgccgatcacgccctgcccgccaacgtcgccccggccctgccggca
gtggatgacggcagcctggccaagcgtttcgaaccggtggcgcgggtgttcgccgagaac
aacgcagaaggcgccgacagcaccatcatggaccgctacctggctgcgctgcgcaagctc
aaggtgcgcatgaacaacatccagcgctcgcaggatgtgggaaagggcagcaagcagttg
atcagcgagaccctggaaggccagccgagcgaagtcaccaccgtacgcaattatgtggaa
ggcagcgtcgataccagccaggacggcctgtcccgctccttgcaggggctgttcagcctg
cccatccagtacgcctgggccaccctgcgcgacccggccggccagcaaatcgccaaagcc
tgggcacagcagatcgccaaaccgtgggaacaggtcatggcgcaccgttaccccattgcc
ggtagcagcaacaacgaagcgtcggtgaaagacctgcagcgcttcgtcgacccgcaaagc
ggcctgctcccggcgttcaagcgtaacgaaatcggcaacctggccggcggtgaaggcctg
ggcgtgggtgacagcaaggggccagcgctggtcaaccccggcatgctcaacagcatcgac
aaggccagctcggtgggccaggtgatcgccagcctctcggaccgtgacaacggctttgag
atcatgctggagccttcggccaacttcaccgacatcgtgttcacgctcgatggccaggaa
cagcactaccgtaacggccgcagcagctggaaccgctttgcctggccggccaccagcaac
gcccccggcgcacgcctggacgtggttaccctgagcggcgcacggcttaccgtgttcgac
ttcccgggccgatggggccttctgcgcatgaacgaaagcgcccgcgtcgacgacctggac
ggcattcagcaacgctttagctggaacaccgccagtggccgcgtgagccttgttgtacgc
aacttcggtggggtcaagctgaccgatctgggtaacgtcaaggccctgagcgccctcaac
gacaggggcgcgcaatga

DBGET integrated database retrieval system