KEGG   Pseudomonas putida NBRC 14164: PP4_24470Help
Entry
PP4_24470         CDS       T02707                                 

Definition
(GenBank) putative type VI secretion system protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PP4_24470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppun02044]
    PP4_24470
Secretion system [BR:ppun02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP4_24470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU Far-17a_AIG1
Motif
Other DBs
NCBI-ProteinID: BAN54300
Position
complement(2788425..2789141)
Genome map
AA seq 238 aa AA seqDB search
MTEAVLQQGAVAAANDKPTLKDLVQDFISMALIVRRGRQVTSVQAFEGSVERFFTNLERD
ARAANYSVEQVKDTQYALCAFLDESVLRSGDNELRRHFELQPLQFRYFGVHLAGEGFFEK
VDALRADVKQNIDVLEVYHLCLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALS
PDWALPDQVSQMLRHEVPLWVYLTLIALVCIAVYLTLDWLLDKDVAALSEQIRQLFSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtattgcaacagggcgccgtcgcggccgccaatgacaaaccgacactc
aaggacctggtccaggacttcatcagcatggcgctgatcgtgcgtcgcgggcgccaggtc
acctcggtgcaggctttcgaaggcagcgtcgagcgctttttcaccaacctggagcgtgat
gcccgcgccgccaactacagcgtcgagcaggtcaaggacacccaatacgcgctgtgcgct
ttcctcgacgaaagcgtactgcgctcaggcgacaacgaactgcgccggcactttgaactg
cagccgttgcagttccgctatttcggcgtgcacctggcaggtgaaggcttcttcgaaaaa
gtggatgcgctacgtgccgacgtcaagcagaacatcgacgtgctcgaggtctaccacctg
tgcctggccctgggcttcgagggcaagttcagcctcggccagaaagaccagctgcgctac
ctggccaataccttgggccaggatatcgcccgctaccgcaaggcgcccaaagccctgtca
ccggactgggccctgcccgaccaggtgtcgcagatgctgcgccatgaagtgccgctgtgg
gtgtatctgacgctgatcgcgctggtctgcatcgccgtgtacctcacgctcgactggttg
ctggacaaggacgtcgccgccctgtccgaacaaatccgccagctgttcagtgcctga

DBGET integrated database retrieval system