KEGG   Pseudomonas putida NBRC 14164: PP4_26310Help
Entry
PP4_26310         CDS       T02707                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00540  Lipopolysaccharide biosynthesis
ppun01100  Metabolic pathways
Module
ppun_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    PP4_26310 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ppun01005]
    PP4_26310 (hldD)
Enzymes [BR:ppun01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     PP4_26310 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:ppun01005]
 Unusual sugar
  PP4_26310 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 DapB_N Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: BAN54484
Position
complement(2985316..2986341)
Genome map
AA seq 341 aa AA seqDB search
MTIIVTGAAGFIGSNLVQALNQRNETEIIAVDDLTDGDKFRNLADSEIADYLDKDDFLDR
FACGEFGNVRAVLHQGACSSTVEADGRFMMDNNYRFSRELLASAQQQRVPLLYASSAAVY
GAGQDFREERECERPLNVYGYSKFLFDQQVRRQLMTARSQVVGLRYFNVYGPHEQHKGAM
ASVALHCFNQYQSHGKVSLFGSYGDYPGGGHLRDFVSVDDVVKVNMFFLERPQLSGIFNV
GSGRAQPFNDVALAVINRLREQQDQSPLSLEIALLEGVLEYSEFPDHLRGKYQCYTCADL
ERLRAAGYQASTLTVQQGVARYCDWLQGIKSPPPAPFQQTA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgtaaccggtgccgcaggattcatcggtagcaatctcgtacaggcgctc
aaccagcgcaacgaaaccgagatcatcgccgtcgacgatctgaccgatggcgacaaattc
cgcaacctggccgacagtgaaattgccgactacctggacaaggacgattttctcgatcgc
tttgcttgtggtgagtttggcaacgtgcgtgctgtgctgcaccagggagcgtgttcaagc
accgtcgaagctgatggacgtttcatgatggataacaattaccggttcagccgtgaattg
ctggcgtctgcgcagcaacaacgggtcccgcttttatatgcgtcatcggcagctgtgtat
ggcgccgggcaggattttcgcgaagaacgtgaatgtgagcgcccgctaaacgtctatggc
tattccaagttcctctttgatcaacaggtacgccggcagttgatgacagccaggagccag
gtcgtcggcttgcgttatttcaacgtctacgggccccatgaacagcataaaggtgcgatg
gcgtcagtggccctgcactgcttcaaccagtaccagtcccatggaaaagtcagcctgttc
ggcagctatggtgactatcccggcggtggccatctgcgtgatttcgtctctgtggatgat
gtggtcaaggtcaatatgttcttccttgagcgcccacagttgagcggtatcttcaatgtc
ggcagtggtcgcgcccagccgttcaatgacgttgccttggctgtgatcaatcggctgcgt
gagcaacaagaccaatcgcccttgtcacttgagattgccttgcttgagggggtgcttgag
tacagcgaatttcctgatcatttgcgtggcaagtaccagtgctacacctgtgctgacctg
gagcgcttgcgcgctgccggttaccaggcgtccacattgaccgtccagcaaggcgtggcc
cgctactgcgactggttgcagggtatcaaaagcccgccgcctgctccgttccagcagacg
gcgtaa

DBGET integrated database retrieval system