KEGG   Pseudomonas putida NBRC 14164: PP4_26800Help
Entry
PP4_26800         CDS       T02707                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00071  Fatty acid degradation
ppun00072  Synthesis and degradation of ketone bodies
ppun00280  Valine, leucine and isoleucine degradation
ppun00310  Lysine degradation
ppun00362  Benzoate degradation
ppun00380  Tryptophan metabolism
ppun00620  Pyruvate metabolism
ppun00630  Glyoxylate and dicarboxylate metabolism
ppun00640  Propanoate metabolism
ppun00650  Butanoate metabolism
ppun00900  Terpenoid backbone biosynthesis
ppun01100  Metabolic pathways
ppun01110  Biosynthesis of secondary metabolites
ppun01120  Microbial metabolism in diverse environments
ppun01130  Biosynthesis of antibiotics
ppun01200  Carbon metabolism
ppun01212  Fatty acid metabolism
ppun02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP4_26800
   00630 Glyoxylate and dicarboxylate metabolism
    PP4_26800
   00640 Propanoate metabolism
    PP4_26800
   00650 Butanoate metabolism
    PP4_26800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PP4_26800
   00072 Synthesis and degradation of ketone bodies
    PP4_26800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP4_26800
   00310 Lysine degradation
    PP4_26800
   00380 Tryptophan metabolism
    PP4_26800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP4_26800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP4_26800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PP4_26800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppun04147]
    PP4_26800
Enzymes [BR:ppun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PP4_26800
Exosome [BR:ppun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP4_26800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAN54533
Position
complement(3044314..3045522)
Genome map
AA seq 402 aa AA seqDB search
MDKQDVVIVATARTALSKSFRGSFNDTEAPVLGGHVVRAVVERAGIEPGAVDDVIMGAAV
QQGTQGYNIGRLCAYTGGLPDSVPGMALDRMCASGLISIGMAAKNILAGEMSIVIGGGVE
SLSLTQNKHKNTYRNQSEAVLACMPSAYIPMIETAEIVARRYGISRAAQDDYSLQSQQRT
AAAQRDGLFDEEIVPLQVRKLRFDKEGQPDGHEQVVAERDECNRPSTRFEDLAALKPVWK
NGQWVEQGEFITAGNASQFSDGASASLLMSRAEAARLGLKPLGTYRGIAVAGCAPEEMGI
GPVLAVPKLLKRFGLSVADIGLWEINEAFACQVLHCRDALGIPAERLNVNGGAISIGHPF
GMSGARMVGHGLLEGRRRGVRYVVVAMCIGGGMGAAGLFELD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcaagacgttgtaatcgtagcgactgcccgtaccgcgctgagcaaatccttt
cgcggctctttcaacgacaccgaagccccggtgcttggcggccatgtggtgcgcgcggtg
gtcgagcgtgccggtatcgagcctggcgcggtggatgacgtgatcatgggcgcggcggta
cagcagggcacccagggctacaacattggcaggctgtgtgcctacaccggcggtttgccc
gacagcgtgccgggcatggccctggaccgtatgtgcgcttccggcctgatcagtatcggc
atggcggcgaagaacattctggccggtgaaatgagcattgtcattggcgggggggtcgag
tcgctgtcgctgacccagaacaagcacaagaacacctaccgcaaccagtcggaggcggtg
ctggcgtgcatgccaagcgcctatatcccgatgatcgaaaccgccgagatcgttgcccgg
cgctatggcatcagtcgcgcggcccaggacgactactcactgcaaagtcagcagcgcacc
gcagccgcccagcgcgacggcctgttcgacgaagaaatcgtaccgctgcaagtgcgcaag
ctgcgctttgacaaggaaggccagcccgatggccatgagcaggtggtggccgagcgcgac
gagtgcaaccgtccttcgacccgcttcgaagacctggcggcgttgaaacccgtgtggaag
aacggccaatgggtcgagcagggcgagttcattaccgccggcaacgcctcacagttctcc
gacggcgcatcggccagcttgctgatgagccgggccgaggccgcccggcttggcctgaag
ccgctggggacgtaccgcggcatcgccgtggccggctgcgcgccggaagaaatgggcatc
ggcccggtgctggcggtgcccaagctgctcaaacgcttcggtttgagcgtggccgacatc
gggctgtgggaaatcaacgaagcctttgcctgccaggtcctgcattgccgcgacgccctg
ggcatccctgcggagcgcctgaacgtcaacggcggggctatttcgattggtcacccgttc
ggcatgtcgggtgcgcgtatggtcggtcatggcctgctggaagggcgccgccgcggcgtg
cgctacgtggtcgtggccatgtgcatcggggggggcatgggcgcggcgggcctgttcgag
ctggactga

DBGET integrated database retrieval system