KEGG   Pseudomonas putida NBRC 14164: PP4_29310Help
Entry
PP4_29310         CDS       T02707                                 

Definition
(GenBank) putative catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00380  Tryptophan metabolism
ppun00630  Glyoxylate and dicarboxylate metabolism
ppun01110  Biosynthesis of secondary metabolites
ppun01130  Biosynthesis of antibiotics
ppun01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PP4_29310
  Amino acid metabolism
   00380 Tryptophan metabolism
    PP4_29310
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PP4_29310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase
Motif
Other DBs
NCBI-ProteinID: BAN54784
Position
3331044..3332096
Genome map
AA seq 350 aa AA seqDB search
MTMNSPLHGPAKAVRLAAIGAVMLAAGAGFAYAAGWLGESRLTPQRIIDTFEAQAGHYPG
YRKNHAKGLCVSGYFQASGQAANLSTARVFSQARVPVTGRFAIGGANPFAPDTGIPVRSL
AIQLSTDDGQVWRTGMNNPPVLAISTPQGFYEQVLANTPDPATGKPNPASLQAFFAAHPE
SAAFRQWAAGYKPSNSFASTQYHSINAFHLIDAGGTRHPVRWQLEPQTAFAALPTQIDDK
QFLQHDLQQRLAQGPLRWTLRLVLAEPGDAVDDPARPWPAERRSVDAGTLVLEQVDAPEQ
GACRDLNFDPLILPRGIEASADPILAARSAAYSESFNRRSRESLSTGARP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaactcacctttgcacggcccggcgaaagccgtgcgcctggctgccatcggc
gccgtgatgctggccgcaggcgccggctttgcctacgccgccggctggctcggcgaaagc
cggctgacgccacagcgtatcatcgataccttcgaggcccaggccgggcattacccaggc
taccggaagaaccatgccaagggcctgtgcgtcagcggctacttccaggccagcgggcag
gccgccaacctttctactgcgcgcgtcttcagccaggcacgcgtgccggtaaccggccgt
ttcgccattggcggtgccaacccgttcgcaccggacaccggcatacccgtgcgcagcctg
gccattcagctgagtaccgacgacgggcaggtatggcgcaccggcatgaacaacccgcca
gtgctggcaatcagcacaccgcaagggttctacgagcaagtgctggccaacacgccagac
ccggccaccggcaaaccgaaccctgccagcctgcaggcgtttttcgcagcccacccggag
agcgcggcgtttcgccaatgggcggcgggctataagcccagcaacagcttcgccagcacc
caataccacagtatcaacgcctttcacctgatcgacgcaggcggcacgcgccacccggtg
cgctggcagcttgagccgcaaaccgcgtttgccgcgctgcccacccagatcgatgacaaa
cagtttctacaacacgacctgcagcaacgcttggcccagggccccttgcgctggacgctt
cgcctggtgctggccgaacccggcgatgcggtggatgaccctgcccggccctggcccgcc
gagcggcgcagcgtagacgccggcaccctggtgctggaacaggtcgacgcccctgagcag
ggggcatgccgcgacctcaatttcgacccgttgatcctgccccgaggcatagaggcatct
gccgacccgatcctcgccgcccgttcggctgcctactcggaatcgttcaaccgccgcagc
cgtgaatcgctcagcaccggagcccgcccatga

DBGET integrated database retrieval system