KEGG   Pseudomonas putida NBRC 14164: PP4_33700Help
Entry
PP4_33700         CDS       T02707                                 

Gene name
nfnB
Definition
(GenBank) nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00633  Nitrotoluene degradation
ppun01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PP4_33700 (nfnB)
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     PP4_33700 (nfnB)
  1.-  
   1.-.-  
    1.-.-.-  
     PP4_33700 (nfnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: BAN55223
Position
complement(3834185..3834838)
Genome map
AA seq 217 aa AA seqDB search
MDTVSLAKRRYTTKAYDASRRIPQATVDALLEQLRHSPSSVNSQPWHFIVADTAEGKARL
AKSTTEGYAYNTPKLLDASHVIVFCTRTEMTEAHLNAVLDQEAADGRFRDEQARAGQNQS
RRHYVNLHRYDHKDVQHWMEKQTYLALGTALLGAAAHGLDATPIEGFDSKILDAELGLRE
RGFTSVVILSLGYRSESDFNAGLNKSRLPASQVFTFL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggataccgtctcgctggccaagcgccgctacaccaccaaagcctacgatgcctcgcgc
cgcattccccaggccactgtcgatgccctgctcgaacaactgcgccacagcccgtcctcg
gtcaactcccagccgtggcacttcattgtcgccgatactgccgaaggcaaggcccgcctg
gcaaaaagcacgactgagggttacgcctacaacacgccgaagctgctcgatgcctcgcac
gtgatcgtgttctgcacccgcaccgaaatgaccgaagcgcacctgaatgcggtgctcgat
caagaggccgccgatggccgtttccgtgacgaacaggcgcgtgccgggcagaaccagagc
cgccgtcactacgtgaacctgcatcgctacgaccataaggatgtgcagcactggatggaa
aagcagacctacctggccttgggcacggcattgctgggtgctgccgcacatggcctggat
gcaacacccatcgagggctttgacagcaagatcctcgatgccgagctgggcttgcgtgag
cgtggttttaccagcgtggtgatcctcagcctgggttatcgcagtgaatcggacttcaac
gccgggttgaacaagtcacggttgccggcttcgcaagtgttcaccttcctctga

DBGET integrated database retrieval system