KEGG   Pseudomonas putida NBRC 14164: PP4_40940Help
Entry
PP4_40940         CDS       T02707                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00860  Porphyrin and chlorophyll metabolism
ppun01100  Metabolic pathways
Module
ppun_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PP4_40940 (cobQ)
Enzymes [BR:ppun01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     PP4_40940 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: BAN55947
Position
complement(4659925..4661379)
Genome map
AA seq 484 aa AA seqDB search
MTTLMVQGTTSDAGKSTLVTALCRWLLRQGVGVVPFKPQNMALNSAVTADGGEIGRAQAV
QAQACRLAPHTDMNPVLLKPNSDTGAQVIIHGRAVTSMNAVAYHDYKAIAMQAVLASHQR
LSAAWPVVMVEGAGSPAEINLRAGDIANMGFAEAVDCPVILVADINRGGVFAHLVGTLEL
LSPSEQARVKGFVINRFRGDIALLQPGLDWLEQRTGKPVLGVLPYVTDLHLEAEDGIDVR
QGAKTERVLKVIVPVLPRISNHTDFDPLRLHPQVDLQFIGPGQPIPAADLIILPGSKSVR
GDLAQLRERGWDKAIERHLRYGGKLIGICGGLQMLGRDVHDPLGLEGAAGSSPGLGLLDY
ATVLEAEKQLRNVAGTLNLEAAPVGGYEIHAGVTTGPALEQPAVQLADGRCDGAVSADGQ
ILATYLHGLFEGSQSCAALLRWAGLEDVQSIDYEALRERDIERLADLVEKHLDTAHLRQL
CGVA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcatggtgcaaggcaccacctccgacgccggcaagagcacgctggtaact
gccctgtgccgctggctgttgcgccagggcgttggcgtggtgccgttcaaaccacagaac
atggcgctgaacagcgcggtgactgccgacggcggcgaaattggccgcgcccaggcggtg
caagcgcaggcgtgccggctggcaccccacaccgacatgaaccccgtgttgctcaaaccc
aacagcgataccggcgcccaggtcatcatccacggccgtgcggtcaccagcatgaacgcg
gtcgcttaccatgattacaaggccatcgccatgcaggcggtgctggcttcgcaccagcgc
ctgagtgccgcctggccggtggtcatggtcgaaggcgcggggtcgccggcggagatcaac
ctgcgtgctggcgacatcgccaacatggggtttgccgaagcggtggactgcccggtgatc
ctggtcgccgacatcaaccgcggcggtgtgttcgcgcacctggtgggcacgctggagttg
ctgtcgcccagtgagcaggcgcgggtcaaaggctttgtcatcaaccgcttccgtggtgat
atcgccttgttgcagccggggctcgactggctggagcaacgcaccggcaagccagtgctg
ggggtgctgccttacgtcactgacctgcacctggaagccgaagacggcatcgatgtgcgc
caaggcgccaagaccgagcgcgtgctcaaggtgatcgtcccggtactgccgcgcatcagc
aaccacaccgacttcgacccgttgcggctgcacccgcaggtcgacctgcagttcattggc
ccgggccagccgatcccggctgccgacctgatcatcctgccgggttccaagagcgtgcgc
ggtgacctggcgcagttgcgcgagcgcggttgggacaaggccatcgagcggcacctgcgc
tacggtggcaagctgatcgggatctgcggtggcctgcaaatgcttggccgcgacgtgcat
gacccgctgggtctcgaaggggctgcaggttcaagcccggggctgggcctgctcgattac
gccacggtgctggaagccgagaagcaactgcgcaacgttgccggcacgctgaaccttgaa
gcagcaccggttggcggctatgaaattcacgctggcgtcaccaccggccctgccttggag
cagcccgccgtgcagttggccgatggccgctgtgatggcgctgtcagtgccgatggccag
atcctcgccacctacctgcacggcctgttcgagggcagccagtcgtgtgctgcgctgctg
cgctgggctggcctggaggatgtgcagagcatcgattacgaagccctgcgcgaacgcgac
atcgagcgcctggccgacctggtggaaaagcacctggacaccgctcacctgcgccaactg
tgcggggtggcctga

DBGET integrated database retrieval system