KEGG   Pseudomonas putida NBRC 14164: PP4_43160Help
Entry
PP4_43160         CDS       T02707                                 

Gene name
arcB
Definition
(GenBank) ornithine carbamoyltransferase ArcB
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00220  Arginine biosynthesis
ppun01100  Metabolic pathways
ppun01110  Biosynthesis of secondary metabolites
ppun01130  Biosynthesis of antibiotics
ppun01230  Biosynthesis of amino acids
Module
ppun_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PP4_43160 (arcB)
Enzymes [BR:ppun01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     PP4_43160 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: BAN56169
Position
4895445..4896455
Genome map
AA seq 336 aa AA seqDB search
MAFNIHNRNLLSLEHHTNRELRYLLDLSRDLKRAKYTGTEQQHLKGNNIALIFEKTSTRT
RCAFEVAAYDQGANVTYIDPNSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVEELAK
FAGVPVFNGLTDEYHPTQMIADVLTMRENSDKPLHDISYAYLGDARNNMGNSLLLIGAKL
GMDVRIAAPKALWPHDDLVERCKKYAEESGARITLTEDPKAAVKGVDFVHTDVWVSMGEP
IEAWGERIKQLKPYQVNAELMKSTGNPRTKFMHCLPAFHNSDTKVGKQIAEQYPDLANGI
EVTDDVFESPACIAFEQAENRMHTIKAILVSTLADL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaacattcacaaccgcaacctgctcagcctggaacaccacaccaaccgcgaa
ctgcgctacctgctggacctgtcccgcgacctcaagcgtgccaagtacactggcaccgag
cagcagcacctgaagggcaacaacatcgcgctgatcttcgaaaaaacctccacccgtacc
cgctgcgccttcgaagtggcggcttacgaccagggcgcgaacgttacctacatcgacccc
aactcttcgcagatcggccacaaagagagcatgaaggacaccgcccgcgtgctcgggcgc
atgtacgacgcaatcgagtaccgtggcttcaagcaggaaatcgtcgaagagctggccaag
tttgccggcgtaccggtgttcaacggcctgaccgatgagtaccaccccacccagatgatc
gctgacgtgctgaccatgcgcgagaacagcgacaagccgctgcacgacatcagctacgcc
tacctgggcgacgcccgcaacaacatgggcaactcgctgctgctgattggcgccaagctc
ggcatggatgtgcgcatcgccgcgccaaaggcactgtggccgcatgacgacctggtcgag
cgctgcaagaagtacgctgaggaaagcggcgcccgcatcaccctcaccgaagacccgaaa
gcggcggtcaagggtgtggactttgttcataccgacgtgtgggtttcgatgggcgagccg
atcgaagcctggggtgagcgcatcaagcagctcaagccttaccaggtgaatgccgagctg
atgaagtccactggcaacccacggaccaagttcatgcactgcctgccggcgttccataac
tccgacaccaaggtaggcaagcagatcgccgaacagtacccggacctggccaacggcatc
gaagtgactgacgacgtgttcgagtcgccggcctgcatcgccttcgagcaggcggaaaac
cgcatgcacaccatcaaagcgatcctggtgtcgaccctggctgacctctga

DBGET integrated database retrieval system