KEGG   Pseudomonas putida NBRC 14164: PP4_50420Help
Entry
PP4_50420         CDS       T02707                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00670  One carbon pool by folate
ppun01100  Metabolic pathways
ppun01120  Microbial metabolism in diverse environments
ppun01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PP4_50420 (metF)
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     PP4_50420 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: BAN56895
Position
5707547..5708392
Genome map
AA seq 281 aa AA seqDB search
MSQERRYSFEFFPTKTDAGHEKLMGVARQLATYNPDFFSCTYGAGGSTRDRTLNTVLQLE
SEVKVPAAPHLSCVGDSKDDLRALLAEYKAAGIKRIVALRGDLPSGMGMASGELRYASDL
VEFIRQETADHFHLEVAAYPEMHPQARNFETDLANFVHKVKAGADSAITQYFFNADSYFY
FVERAQKLGVDIPVVPGIMPITNYSKLARFSDACGAEIPRWIRKQLEAYADDTASIQAFG
EEVITRMCEQLLQGGAPGLHFYTLNQAEPSLAIWNNLKLPR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaacgccgctacagtttcgagttcttcccgaccaagaccgacgccggtcac
gaaaagctgatgggcgtcgcccgccagctggccacctacaacccggacttcttctcctgc
acctacggtgccggtggctcgacccgcgaccgcacgctgaacaccgtgctgcagctggaa
agcgaagtgaaggtacccgccgcaccgcacctgtcgtgcgtgggcgactccaaggacgac
ttgcgcgccctgctggcggaatacaaggctgccggcatcaagcgcatcgtcgccctgcgt
ggcgacctgccatcgggcatgggcatggccagtggcgaactacgctacgccagcgacctg
gtcgagttcatccgccaggaaaccgctgaccacttccacctggaagtggccgcctacccg
gaaatgcacccacaggcgcgcaatttcgaaaccgacctggccaacttcgtgcacaaggtc
aaggctggcgccgacagcgccatcacccagtacttcttcaacgccgacagctacttctac
ttcgtcgagcgcgcacagaagctgggcgtggacatcccggtggtacccggcatcatgccg
atcaccaactacagcaagctggcgcgcttctccgacgcttgtggcgccgagatcccgcgc
tggatccgcaagcagctggaagcctatgccgacgacaccgccagcatccaggcatttggc
gaagaagtgattacccgcatgtgcgaacagctgctgcaaggcggcgcaccgggcctgcac
ttctacaccttgaaccaggccgagccaagcctggcgatctggaacaacctgaagctgccg
cgctga

DBGET integrated database retrieval system