KEGG   Pseudomonas putida NBRC 14164: PP4_54120Help
Entry
PP4_54120         CDS       T02707                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00030  Pentose phosphate pathway
ppun00480  Glutathione metabolism
ppun01100  Metabolic pathways
ppun01110  Biosynthesis of secondary metabolites
ppun01120  Microbial metabolism in diverse environments
ppun01130  Biosynthesis of antibiotics
ppun01200  Carbon metabolism
Module
ppun_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppun_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ppun_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PP4_54120 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PP4_54120 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppun04147]
    PP4_54120 (zwf)
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PP4_54120 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PP4_54120 (zwf)
Exosome [BR:ppun04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PP4_54120 (zwf)
  Exosomal proteins of colorectal cancer cells
   PP4_54120 (zwf)
  Exosomal proteins of bladder cancer cells
   PP4_54120 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAN57265
Position
6116958..6118415
Genome map
AA seq 485 aa AA seqDB search
MESGGLTIPCDILVFGGTGDLALHKLLPALYHLYREARLNNAVRIIALARRNISRNEYLK
LAERHCRAQIARNDFDEDIWQRFAARLDYFPMDASQSADFGRLARYLGEPGGLTRIFYLA
TAPNLFVPIANHLRNAGLADPEARIVLEKPIGHSLASATAINEAIGAVFDENQVFRIDHY
LGKETVQNLMALRFANALLEPVWRNNQVDHVQISVCETLGVENRGAYYDRAGATRDMLQN
HLLQLLCLVAMEPPAQFEAEAVRDEKVKILRALKPITGQDVQDKTVRGQYGAGHIGGQEV
PAYYFEKDVDNDSDTETFVAIEAHIDNWRWAGVPFYLRTGKRMARRSSQIVIQFKPVPHE
LFSGGQVNQLLIQLQPDERISLRMMTKSPGKGMRLEPVELDLNLAQVFSQTRRWEAYERL
LLDIVEGDSTLFMRRDEVEAAWHWIDPLMKGWQEHFQAPRHYAAGSNGPEQAGSLLARHG
RHWYS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggagagtggcggtttgactattccttgcgacattctggtgttcggtggcaccggcgat
ctggccctgcacaaactcctcccggcgctctatcacttgtatcgcgaggcgcgtctgaac
aacgcggtacgcatcatcgccctcgcccgccgcaacataagccgtaacgaatacctcaag
ctcgcagaacgccattgccgagcgcagattgcccgcaatgacttcgacgaagacatatgg
caacggtttgccgcgcgcctcgactactttcccatggatgcttcgcaaagcgccgacttc
ggccgcctggcgcgctacctgggcgaacctggcgggctgacgcgcattttctacctggcc
accgctcccaacctgttcgtgccgattgccaatcacctgcgtaacgcaggcctggccgac
cccgaagcgcgcatcgtgctggagaagccgattggtcactcgctagcctcggccaccgcc
atcaacgaagcgattggcgcagtgttcgacgaaaaccaggtatttcgcatcgaccactac
ctgggcaaggaaaccgtgcagaacctcatggccctgcgcttcgccaacgccctgttggag
ccggtgtggcgcaacaatcaggtcgaccacgtacagatcagcgtttgcgaaaccctgggg
gtagagaaccgcggcgcctactacgaccgcgccggggcaacccgcgacatgctgcaaaac
cacctgttgcagctgctgtgcctggtggccatggagccacctgcgcagttcgaggctgaa
gcggtgcgcgacgaaaaggtgaagatcctgcgggccctcaaacccatcaccggccaggac
gtgcaggacaagaccgtgcgcggtcagtacggtgccgggcacatcggcggccaggaggtg
ccggcctattacttcgaaaaggacgtcgacaacgacagcgataccgaaaccttcgtggcc
atcgaagcgcacatcgacaactggcgctgggcaggtgtgcctttctacttgcgcaccggc
aagcgcatggcgcgccgctcgtcgcagatcgtcatccagttcaagccggtaccccacgag
ctgttcagcggtggccaggtcaaccagctgttgatccagctgcaaccggatgagcgcatc
agcctgcgcatgatgaccaagagcccaggcaagggcatgcggctggagccagtcgagctg
gacctgaacctggctcaggtattcagccagacccgccgctgggaagcttacgaacgcctg
ctgctggacatcgtggagggtgattcgacactgttcatgcgccgcgatgaggtggaggcg
gcctggcactggattgatccgttaatgaagggttggcaggaacactttcaggcgccacgc
cactatgccgccgggagcaatggcccggaacaggccggtagcctgctggccaggcatggc
aggcattggtacagctga

DBGET integrated database retrieval system