KEGG   Pseudomonas putida H8234: L483_01635Help
Entry
L483_01635        CDS       T02706                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00260  Glycine, serine and threonine metabolism
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
pput01120  Microbial metabolism in diverse environments
pput01130  Biosynthesis of antibiotics
pput01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    L483_01635
Enzymes [BR:pput01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     L483_01635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGN77436
UniProt: R9UZV7
Structure
PDB: 

Position
complement(345316..346356)
Genome map
AA seq 346 aa AA seqDB search
MTDKSQQFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERASEYFRNLFETDCEVFF
AFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTAASVDGKLTPE
SIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTN
ACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASK
MRFLSAPWVGLLEDGAWLRHGNHANHCAQLLASLVSDLPGVELMFPVEANGVFLQMPEPA
IEALRGKGWRFYTFIGSGGARFMCSWDTEQERVRELAADIRSIITA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacagataagagccaacaattcgccagcgacaactattccggtatctgccccgaagcc
tgggcggcgatggaaaaggccaaccacggccacgaccgcgcctatggcgacgatcaatgg
accgagcgcgcctcggaatacttccgcaacctgtttgaaaccgactgcgaggtatttttc
gccttcaacggcaccgccgccaactccctggccctggcctcgctgtgccagagctaccac
agcgtcatttgctccgagaccgcccacgtcgaaaccgacgaatgcggcgcgccggagttc
ttttccaacggctccaagctgctgacggccgccagcgtcgacggcaagctgacgccagag
tccatccgcgaagtggcgctgaagcgccaggacatccactaccccaagccgcgggtcgtg
accattacccaggccacagaagtgggcaccgtgtaccgccccgacgagctgaaggcgatc
agcgcgacctgcaaggagctggggctgaacctgcacatggacggcgcgcgctttaccaat
gcctgcgcattcctgggctgcagcccggccgagctgacctggaaggccggtgtggatgta
ttgtgcttcggcggcaccaagaacggcatggcggtgggtgaagcaatcctgttcttcaac
cgccaactggccgaagacttcgattaccgctgcaagcaggccggtcaactggcgtcgaaa
atgcgcttcctgtctgcgccatgggtggggctgctggaagatggcgcctggttgcgccat
ggcaaccacgccaaccattgcgcgcagttgctggcatcgttggtgagtgacttgccgggg
gtggagctgatgttcccggtggaggccaacggggtgttcctgcaaatgccggagcctgcg
attgaagcgctgcgcggcaaggggtggaggttctatacctttatcggcagcggcggggca
cggttcatgtgttcctgggataccgagcaagagcgggtgcgcgaactggcagcggatatc
cgcagtatcatcaccgcctga

DBGET integrated database retrieval system