KEGG   Pseudomonas putida H8234: L483_02890Help
Entry
L483_02890        CDS       T02706                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    L483_02890
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     L483_02890
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     L483_02890
    1.1.1.-  
     L483_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGN81345
UniProt: R9VC10
Position
complement(618446..619534)
Genome map
AA seq 362 aa AA seqDB search
MNDLSHTHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCGICGSDLHEYVAGPVFI
PVEAPHPLTGIQGQCILGHEFCGQIAKLGEGVEGFAVGDPVAADACQHCGTCYYCTHGLY
NICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAGALIEPLAVGMHAVKKAGSLL
GQTVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAKEVGASVVLDPSQCDALAQ
IRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKCVLVGIFEEPSEFNFFELVSTEKQV
LGALAYNGEFADVIAFIADGRLDIRPLVTGRIGLEQIVELGFEELVNNKEENVKIIVSPG
VR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgagccacacccatatgcgcgccgccgtctggcatggccgcaacgatatt
cgcgtcgaacaggtacccctgccagccgaccctgcgccgggctgggtacagatcaaggtg
gactggtgcggcatctgcggctccgacctgcacgaatacgtcgccggcccggtattcatc
ccggtggaggccccgcacccactgactggcattcagggccagtgcatcctcggccacgaa
ttctgcggccagatcgccaagctgggtgaaggcgtggaaggctttgcggtcggcgacccg
gtggccgcagacgcctgccagcattgcggcacctgctactactgcacccacggcctgtac
aacatctgcgagcgcctggccttcaccggcctgatgaacaacggcgccttcgccgagttg
gtcaacgtgcctgccaacctgctctaccggctgccgcagggcttccctgctgaagccggg
gcactgatcgagccgctggcagtgggcatgcatgcagtgaaaaaggcgggcagcctgctc
ggccaaaccgtggtggtggtgggtgctggtaccattggcctgtgtaccatcatgtgcgcc
aaggctgcgggagcagcgcaggtcattgcccttgagatgtcctcggcgcgcaaggccaaa
gccaaggaagtcggtgccagcgtggtgctggaccccagccagtgcgatgccctggcgcaa
atccgcgcactcactgccgggttgggggcggatgtgagctttgagtgcatcggcaacaag
cacacggccaagttggccatcgacaccatccgcaaggcgggcaagtgtgtgctggtgggc
attttcgaagagcctagcgagttcaactttttcgaactggtgtccaccgagaagcaggtg
ctgggggcgttggcgtacaacggtgaatttgccgatgtgattgcctttatcgctgatgga
cgactggatattcgccccttggtgaccgggcggatcgggctggagcagattgtcgagctg
ggcttcgaggaactggtgaacaacaaggaagagaacgtgaagatcatcgtttcaccgggc
gtgcgctga

DBGET integrated database retrieval system