KEGG   Pseudomonas putida H8234: L483_10035Help
Entry
L483_10035        CDS       T02706                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00350  Tyrosine metabolism
pput00360  Phenylalanine metabolism
pput00380  Tryptophan metabolism
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    L483_10035
   00360 Phenylalanine metabolism
    L483_10035
   00380 Tryptophan metabolism
    L483_10035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pput04147]
    L483_10035
Enzymes [BR:pput01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     L483_10035
    4.1.1.105  L-tryptophan decarboxylase
     L483_10035
Exosome [BR:pput04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L483_10035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF1148
Motif
Other DBs
NCBI-ProteinID: AGN78728
UniProt: R9V5R9
Position
2151142..2152554
Genome map
AA seq 470 aa AA seqDB search
MTPEQFRQYGHQLIDLIADYRQTVGERPVMAQVEPGYLKAALPDTAPRQGEPFEAILDDV
NRLVMPGLSHWQHPDFYGYFPSNGTLSSVLGDFLSTGLGVLGLSWQSSPALSELEETTLD
WLRQLLGLSGQWSGVIQDTASTSTLVALISARERASDYALVRGGLQAQAKPLIVYVSAHA
HSSVDKAALLAGFGRDNIRLIPTDERYALRPQALQAAIEQDLAAGNQPCAVVATTGTTTT
TALDPLRPIGEIAQAHGLWLHVDSAMAGSAMILPECRWMWDGIELADSVVVNAHKWLGVA
FDCSIYYVRDPQHLIRVMSTNPSYLQSAVDGEVKNLRDWGIPLGRRFRALKLWFMLRSEG
VEALQARLRRDLDNARWLAEQVGAAAHWEVLAPVQLQTLCIRHRPAGLEGEALDAHTKGW
AERLNASGDAYVTPATLDGRWMVRVSVGALPTEREHVETLWKRLQEVVEG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccgaacaattccgccagtacggccaccaactgatcgacctgatcgccgactac
cgccagaccgttggcgagcgcccggtcatggcccaggtcgagcccggctacctcaaggcc
gccttgcccgacaccgctccccggcaaggtgaacccttcgaagccatcctcgacgacgtc
aaccggttggtcatgcccggcctgtcccattggcagcatccggacttctacggctacttc
ccctccaacggtactctgtcctcggtactcggcgacttcctcagcaccggcctgggtgtg
ctaggcctgtcgtggcagtccagccccgcactcagcgaactggaggaaaccaccctcgac
tggctgcgccagttgctcggcctgtcgggccaatggagcggggtgatccaggacaccgcc
tctaccagcaccctggtggcgctgatcagcgcccgcgagcgcgccagcgactacgcactg
gtgcgcggtgggctgcaagcccaggccaaacccctgatcgtctacgtcagcgcccacgcc
cacagctcggtggacaaggccgcgttgctggcgggttttggtcgcgacaatattcgcctg
atccccaccgacgaacgctacgccctgcgcccgcaggcgctgcaggcagccattgagcaa
gacctggcagcgggtaaccagccatgcgccgtagtggctactaccggtaccaccaccacc
actgcgctggacccgttgcgcccgattggcgagatcgcccaggcccatggcctgtggctg
catgtggattcggccatggccggttcggcgatgatcctgcccgaatgccgctggatgtgg
gacggcatcgagctggccgattcggtagtggtcaatgcgcacaagtggctgggtgtggcc
tttgactgctcgatctactacgtgcgtgatccgcagcatctgatccgggtgatgagcacc
aaccccagctacctgcaatcggcggtggatggcgaggtgaaaaacctgcgtgactggggc
atcccgctgggccgccggttccgcgcgttgaagctgtggttcatgttgcgcagcgagggt
gttgaagcgttgcaggcgcggttgcggcgtgacctggacaatgcccggtggctggcggag
caggttggggctgcggcgcactgggaagtgctggcaccggtgcaattgcagaccttgtgc
attcgccatcggccggcggggctggaaggggaggcgctggatgcgcataccaaggggtgg
gccgagcggttgaatgcctccggggatgcgtatgtgacgccggcgacgctggacggacga
tggatggtgcgggtgtcggtgggggcgctgccgactgagcgggagcatgtcgagacgctt
tggaagcgactgcaagaagtggttgaaggctga

DBGET integrated database retrieval system