KEGG   Pseudomonas putida H8234: L483_12080Help
Entry
L483_12080        CDS       T02706                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00051  Fructose and mannose metabolism
pput01100  Metabolic pathways
pput01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    L483_12080
Enzymes [BR:pput01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     L483_12080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AGN81895
UniProt: R9VDJ9
Position
complement(2597974..2599287)
Genome map
AA seq 437 aa AA seqDB search
MSIRITHLSVRDIRFPTSLSLDGSDAMNSAPDYSAAYVVLHTDAEALEGHGLTFTIGRGN
EICAAAVQSLAPLIVGLSLEEITADMGGFWHRFTVSDSQLRWLGPEKGVIHLATAAIINA
VWDLWAKHEGKPVWKLLADMTPEQLVGCLDFSYVTDVLTPEEAIALLRRQAPGKAQREAQ
MLREGYPGYTTAPGWLGYSEDKMRKLAREAVEDGWTHIKQKIGADLEEDIRRASILRDEI
GWERTLMMDANQVWGVEESVANMRRLAAFEPLWIEEPTSPDDILGHATIRQRIAPIGVAT
GEHCHNRVMFKQMFQAGALDFCQLDAARLGGLNEVLIVLLMAAKYDVPVCPHGGGVGLCE
YVQNIALFDYIAVSASLHNRVLEYVDHLHEHFIDPVVIRRGRYMPPQRPGYSIEMHAETL
ERYQYPNGAVWLDINRS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagcatacgtattacccacctgagcgttcgcgacatccgttttccgacctcgctgtcg
ctggacggctccgacgccatgaacagcgcccccgactattcggcagcctacgtggtgctg
cacaccgacgccgaggcccttgagggccacggcctgacgttcaccatcggccgcggcaac
gagatctgcgcagcagcggtgcagtcgctggcacccctgatcgtcggcctcagcctcgaa
gaaatcaccgccgacatgggcggtttctggcaccgctttaccgtcagcgacagccaactg
cgctggctaggccctgagaaaggcgtgatccacctggccactgcggccatcatcaacgcg
gtgtgggacctgtgggccaagcacgaaggtaaaccggtatggaaactgctggcggacatg
acgcctgaacagttggtgggctgcctggacttcagctacgtcacagacgtgctcaccccc
gaggaagccattgccctgctgcgccgccaggcaccgggtaaggcccaacgagaggcgcag
atgctgcgcgaaggctaccccggctataccaccgcgccaggctggttgggttacagcgaa
gataaaatgcgcaaactggcccgtgaggccgtggaggatggctggacccacatcaagcag
aagatcggcgccgacctggaagaagacatacgccgcgccagcatcctgcgcgacgaaatc
ggttgggaacgcaccctgatgatggatgccaaccaggtgtggggcgtggaggagtcagtc
gccaacatgcgccgcctggccgccttcgaaccgctgtggatcgaagagccgaccagcccg
gacgacattctcggccacgccaccattcgccagcgcatcgcgccgatcggtgtggccacc
ggtgagcattgccataaccgggtcatgttcaagcagatgttccaggccggtgcgctggat
ttctgccagctggatgccgcccgactgggtggcctgaacgaagtgctgatcgtgctgctg
atggcggccaagtacgacgtgccggtgtgcccgcacggcggcggtgtcgggctgtgcgaa
tatgtgcagaacatcgccctgttcgactacatcgcagtgtctgcttcgctgcacaatcgg
gtgctggagtacgtcgatcacctgcatgagcacttcatcgacccggtggtgatccgccgt
gggcgctacatgccaccgcaacgcccgggctacagcatcgaaatgcatgccgagaccctg
gagcgctaccagtaccccaacggcgcggtgtggctcgatatcaaccgttcctga

DBGET integrated database retrieval system