KEGG   Pseudomonas putida H8234: L483_14070Help
Entry
L483_14070        CDS       T02706                                 

Definition
(GenBank) glucose-1-dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    L483_14070
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     L483_14070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF4081 Epimerase
Motif
Other DBs
NCBI-ProteinID: AGN79056
UniProt: R9V4L0
Position
complement(2999383..3000156)
Genome map
AA seq 257 aa AA seqDB search
MSILQRFNLTGSVAIVTGSGRGIGRAIALAYADAGADVVCSARSLADVEAVAEEVRSRGR
RALALSCDVTDSEQRCALVANAAEQLGRITHLVNNAGGGGPNDPLKMSPQDFEQVLSFNV
SAAYALSQLCVPLMRDAGGGNIINITSVAARYAQRHFSAYGTAKAALTHLTRLLAQEFAP
QIRVNAVAPGPILTDALAGVMPDAMRKTMESNTPLKCLGQPEDIAAAALYLASPASAWVT
GKIIDVDGGADSSVWPG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctgcaacgcttcaacctcactggcagtgtcgccattgtcaccggcagcggc
cgcggcatcggtcgcgccattgccttggcctacgccgatgctggcgctgatgtagtctgc
agcgcccgttcgctggcagatgtcgaggccgtcgccgaagaggtacgcagccgagggcgg
cgcgccctggccctgagctgcgatgtcaccgacagcgaacagcgctgcgccttggtcgcc
aacgccgccgaacagctggggcgcatcacccatctggtcaacaatgccgggggcggcggc
cccaatgacccgctgaagatgagcccgcaagacttcgagcaggtgttgagcttcaacgtc
agcgccgcctatgccctttcacagctctgcgtacccctgatgcgcgacgccgggggcggc
aacatcatcaacattacctcggtcgccgcccgttatgcccagcgccatttcagtgcctat
ggcaccgccaaggctgccctgactcacctgacgcgcctgctggcacaagagtttgcgccg
cagatccgggtcaatgcggtggcgccagggccaatcctgaccgacgccctggccggggtc
atgcccgatgccatgcgcaaaacgatggaaagcaacaccccgctcaaatgcctggggcaa
ccagaggacatcgccgccgcggccctttacctggcaagccccgcctcggcctgggtcacc
ggcaagatcatcgatgtcgatggcggcgccgattccagtgtctggccgggttga

DBGET integrated database retrieval system