KEGG   Pseudomonas putida H8234: L483_14270Help
Entry
L483_14270        CDS       T02706                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00071  Fatty acid degradation
pput00072  Synthesis and degradation of ketone bodies
pput00280  Valine, leucine and isoleucine degradation
pput00310  Lysine degradation
pput00362  Benzoate degradation
pput00380  Tryptophan metabolism
pput00620  Pyruvate metabolism
pput00630  Glyoxylate and dicarboxylate metabolism
pput00640  Propanoate metabolism
pput00650  Butanoate metabolism
pput00900  Terpenoid backbone biosynthesis
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
pput01120  Microbial metabolism in diverse environments
pput01130  Biosynthesis of antibiotics
pput01200  Carbon metabolism
pput01212  Fatty acid metabolism
pput02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    L483_14270
   00630 Glyoxylate and dicarboxylate metabolism
    L483_14270
   00640 Propanoate metabolism
    L483_14270
   00650 Butanoate metabolism
    L483_14270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    L483_14270
   00072 Synthesis and degradation of ketone bodies
    L483_14270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L483_14270
   00310 Lysine degradation
    L483_14270
   00380 Tryptophan metabolism
    L483_14270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L483_14270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L483_14270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    L483_14270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pput04147]
    L483_14270
Enzymes [BR:pput01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L483_14270
Exosome [BR:pput04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L483_14270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGN79063
UniProt: R9V6R4
Position
3047093..3048244
Genome map
AA seq 383 aa AA seqDB search
MPQAYIVDALRSPTGKRKGSLAHVHAIDLGAHVLKALVERNAIPAHAYDDVIFGCVDAIG
SQAGDIARTSWLAAGLPLNVPGTTVDRQCGSSQQALHFAAQAVMSGMQEVVAVGGVQTMT
QIPISSAMLAGQSLGFSDPFSGSKGWQARFGQQPVNQFYAAQRIADHWQISREDMEVFAL
ESHRRALAAAEAGYFAREIVACEGLAFDETPRVSSLEKMASLEPVSAEFPSITAAVSSQT
CDASAALLVVSEAALKRYNLTPRARIHHLSVLGDDPIWHLTAPIAATRAALKKAGLRMAD
IDLVEINEAFASVVMAWAKELDYDPARTNVNGGAIALGHPLGATGARLMTTLLHSLERTG
GRYGLQTMCEGGGQANVSIIERL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagcgtatatcgtcgatgccctgcgcagccccacgggcaaacgcaaaggcagt
ctggcccacgtgcatgccattgacctgggcgcgcatgtgttgaaagcgctggtcgaacgc
aacgccattcctgcccacgcgtatgacgacgtgattttcgggtgtgtcgacgccatcggc
tcgcaggcgggtgacatcgctcgcaccagctggctggctgccggcttgccgctgaacgtg
ccgggcaccacggtcgaccggcagtgcggttcgtcgcaacaggcgctgcattttgccgcg
caagcggtgatgagtggcatgcaggaggtggtggctgtcggtggtgtgcagaccatgacc
cagatcccgatctcgtcggcgatgctcgctggccaatcgctgggcttcagtgacccgttt
tccggcagcaaaggctggcaggcgcgctttgggcagcagccggtcaatcagttttacgcc
gcacagcgcatcgccgatcactggcagatcagccgcgaagacatggaagtgtttgccctg
gaaagccatcgtcgcgctttggcggctgcagaagccggctatttcgcccgcgagatcgtt
gcctgtgaaggcctggcctttgatgaaacgccgcgggtcagcagcctggagaaaatggcc
agcctggagcctgtgagcgctgagttcccgtcgatcacagccgccgtatcgagccagacc
tgcgatgcgtccgcggccttgctagtggtatcggaggcggcgctcaagcgctacaacctg
acccccagggcgcgtattcatcacctgtcggtgctcggcgacgacccgatctggcacctc
acggcaccgattgcagccacccgtgcggcgctcaagaaggctggcctgcgcatggctgat
atcgaccttgtggaaatcaacgaagcgtttgcctcggtggtcatggcctgggccaaggag
ctcgattacgacccggctcgtaccaacgtcaatggcggcgccatcgcccttggccacccg
ctgggcgctaccggtgcgcgcttgatgaccaccttgctgcattcgcttgaacgcaccggc
gggcgttatggcctgcagaccatgtgtgaaggcggcggccaggccaacgttagcatcatc
gaacggctttga

DBGET integrated database retrieval system