KEGG   Pseudomonas putida H8234: L483_22605Help
Entry
L483_22605        CDS       T02706                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00030  Pentose phosphate pathway
pput00480  Glutathione metabolism
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
pput01120  Microbial metabolism in diverse environments
pput01130  Biosynthesis of antibiotics
pput01200  Carbon metabolism
Module
pput_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pput_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
pput_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L483_22605
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L483_22605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pput04147]
    L483_22605
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     L483_22605
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     L483_22605
Exosome [BR:pput04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   L483_22605
  Exosomal proteins of colorectal cancer cells
   L483_22605
  Exosomal proteins of bladder cancer cells
   L483_22605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AGN79741
UniProt: R9V6F5
Position
complement(4717173..4718678)
Genome map
AA seq 501 aa AA seqDB search
MTKQTIPAAPPCTLFLFGANGDLVKRLLMPALYNLSRDGLLDRNLRIVGVDHNPASAEEF
AERLHAFMLERDKGGEGSAKCLDEKLWARLAKRLDYQTGDFLDPATYQALAKRIDKTSHG
NAIFYLATSPRFFPEVAQRLGQAGLLDESGGGFRRVVVEKPFGTDLASAEALNACLLKVM
GERQIYRIDHYLGKETVQNILVSRFSNGLFESFWNNHYIDHVQITAAETVGVETRGAFYD
STGALRDMVPNHLFQLLAMVAMEPPAAFGADAVRGEKAKVVGAIRPWSAKMALKNSVRGQ
YSAGKQGRKPLPGYRQEPNVAPDSQTETYVALKVMIDNWRWAGVPFYLRTGKRMSVRDTE
IAICFKPAPYAQFRESELERPKPNYLKIQIQPNEGMWFDLQAKRPGPELVMENVELGFAY
KDFFKMTPATGYETLIYDCLTGDQTLFQRADNIENGWRAVQPFLDAWAQDGEVHQYPAGE
DGPDAGNELLSRDKREWHRLG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacagaccattccagccgcacctccctgtaccctgttcctgtttggcgccaat
ggcgacctggtcaagcgcctgctgatgccggcgctgtacaacctcagccgcgacggtttg
ctggaccgcaacttgcgcatcgttggcgtggaccacaacccggccagcgccgaggaattt
gcagagcgcctgcatgcgttcatgctcgagcgggataaaggcggcgagggcagcgccaag
tgcctggacgaaaagctctgggcacgcctggccaagcgcctggattaccagacgggcgat
ttcctcgacccggccacttaccaggccctcgccaagcgcatcgacaaaaccagccacggc
aatgccatcttctacctggccacctcgccgcgtttcttccccgaggtggcgcagcgcctg
gggcaggccggcttgctcgacgagtctggcggcggctttcgccgcgtcgtggtcgagaag
ccattcggcaccgacctggccagcgccgaggcgctcaacgcctgcctgttgaaagtgatg
ggcgaacggcagatctaccgtatcgaccattacctgggcaaagagacggtgcagaacatt
ctggtcagccgcttctccaacggcctgttcgaatccttctggaacaaccactacatcgac
cacgtgcagatcaccgctgcggaaacggtcggcgtcgaaacccgtggtgcgttctacgac
agcaccggggccctgcgcgacatggttcccaaccacctgttccagttgctggcgatggtg
gccatggagccgccggctgcgttcggggctgacgcggtgcgcggcgaaaaggccaaggtg
gtcggtgctattcgcccatggtcggcgaaaatggccctgaagaactcggtacgcggccag
tacagtgccggcaagcaggggcgcaagccgctgcccggttatcggcaggagcccaatgtc
gcgcctgacagccagaccgaaacctacgtggcgctgaaggtgatgatcgacaactggcgc
tgggccggcgtgccgttctacttgcgcaccggcaagcgcatgagcgtgcgcgacaccgaa
attgccatttgcttcaagccggcgccgtatgcgcagttccgcgagtcggagctggagcgg
cccaagcccaactacctgaaaatccagattcagcccaacgaaggcatgtggttcgacctg
caggccaaacggccagggccggagctggtgatggagaatgtggagctgggctttgcctat
aaagacttcttcaagatgaccccggcgaccggctacgagacgctgatttacgactgcctg
accggtgaccagaccctgttccagcgggctgacaacatcgagaacggctggcgagcggtg
cagccgtttctcgatgcctgggcccaggatggcgaggtgcatcagtacccggccggtgaa
gacgggcctgacgctggcaatgaattgctgagccgcgacaagcgcgagtggcaccgcttg
ggctga

DBGET integrated database retrieval system