KEGG   Pseudomonas putida H8234: L483_27290Help
Entry
L483_27290        CDS       T02706                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00051  Fructose and mannose metabolism
pput00520  Amino sugar and nucleotide sugar metabolism
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
pput01130  Biosynthesis of antibiotics
pput02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    L483_27290
   00520 Amino sugar and nucleotide sugar metabolism
    L483_27290
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    L483_27290
Enzymes [BR:pput01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     L483_27290
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     L483_27290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 IspD AraC_binding
Motif
Other DBs
NCBI-ProteinID: AGN80490
UniProt: R9V9I0
Position
5782442..5783899
Genome map
AA seq 485 aa AA seqDB search
MMIPVILSGGSGSRLWPLSRKQFPKQFLALTGEHTLFQQTLERLAFEGMDTPIVVCNKDH
KFIVQEQLAALKLETQGILMEPFGRNTAPAVTMAAMKLVNEGRDDLMLVLPADHVIDDQK
ALQRALALATVAAERGEMVLFGVPATKPETGYGYIRSSQDALLPEGVARVAQFVEKPDEK
RAAEFVQAGGYFWNSGMFLFRASRFLEELKKHDADIYDTCVLALERSEEEDDVLSIDEAT
FACCPDNSIDYAVMEKTQRACVVPMSAGWSDVGCWSSLWDVHEKDDNGNVTKGDVVVQDS
RNCMIHGNGKLVSVIGLENIVVVETKDAMMIAHKDKVQGVKQMVKTLDEQGRTETQNHLE
VYRPWGSYDSVDMGGRFQVKHITVKPGASLSLQMHHHRAEHWIVVSGTAEVTCDENVFLL
TENQSTYIPIASVHRLRNPGKIPLEIIEVQSGSYLGEDDIERFEDVYGRTSTPVERGVSV
KTIAQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcccggtaattctttctggtggtagcggttcgcgtctgtggccactgtcgcgc
aagcagttccccaagcagttcctggccctgaccggcgaacacaccctgttccagcaaacc
ctcgagcgcctggcgttcgaaggcatggacacgccgatcgtggtctgcaacaaggaccac
aaattcatcgtccaggagcagctcgctgcgctgaagctggaaacccagggcatcctgatg
gagccgtttggccgcaacaccgcgccggccgtgaccatggccgccatgaaactggtcaac
gaaggccgcgacgatctgatgctggtgctgcccgccgaccacgtgatcgacgaccagaag
gccctgcagcgcgccctggccttggccaccgttgccgccgagcgtggcgaaatggtgctg
ttcggcgtaccggcgaccaagccggaaaccggctacggctacatccgctccagccaggac
gcgctgctgcccgagggcgtggcgcgcgtggcccagttcgtggaaaaacccgacgaaaaa
cgtgccgccgagttcgtccaggccggtggctacttctggaacagtggcatgttcctgttc
cgcgccagccgcttcctcgaagagctgaaaaagcacgatgccgacatctacgacacctgc
gtgctggccctggagcgcagcgaggaagaggacgatgtactcagcatcgatgaagcgacc
ttcgcctgctgcccggacaactccatcgactacgcggtgatggaaaagacccagcgcgcc
tgcgtggtgccgatgtcggccggctggagcgacgtgggctgctggtcgtcgctgtgggac
gtgcacgagaaggacgacaacggcaacgtcaccaagggcgacgtggtggtacaggacagc
cgcaactgcatgatccacggcaacggcaagctggtgtcggtgatcggcctggagaacatc
gtggtggtcgagaccaaggacgccatgatgattgcccacaaggacaaggtccagggcgtc
aagcagatggtcaagaccctcgacgagcagggccgtactgaaacccagaaccatctggaa
gtgtatcgcccgtggggctcgtacgactcggtggacatgggcggccgcttccaggtcaag
cacatcaccgtcaagccgggtgccagcctgtcgctgcagatgcaccaccaccgtgccgag
cactggattgtggtgtctggtactgccgaggtcacctgtgacgagaacgtgttcctgctg
accgagaaccagtcgacctacatcccgatcgcttcggtccaccgcctgcgcaatccgggc
aagatcccgctggagatcatcgaagtgcagtccggcagctatctgggcgaggatgatatc
gagcgtttcgaggatgtgtatgggcgcacttccacgccggtcgagcgtggggtatcggtc
aagaccatcgcgcagtaa

DBGET integrated database retrieval system