KEGG   Pseudomonas putida H8234: L483_27675Help
Entry
L483_27675        CDS       T02706                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00071  Fatty acid degradation
pput00072  Synthesis and degradation of ketone bodies
pput00280  Valine, leucine and isoleucine degradation
pput00310  Lysine degradation
pput00362  Benzoate degradation
pput00380  Tryptophan metabolism
pput00620  Pyruvate metabolism
pput00630  Glyoxylate and dicarboxylate metabolism
pput00640  Propanoate metabolism
pput00650  Butanoate metabolism
pput00900  Terpenoid backbone biosynthesis
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
pput01120  Microbial metabolism in diverse environments
pput01130  Biosynthesis of antibiotics
pput01200  Carbon metabolism
pput01212  Fatty acid metabolism
pput02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L483_27675
   00630 Glyoxylate and dicarboxylate metabolism
    L483_27675
   00640 Propanoate metabolism
    L483_27675
   00650 Butanoate metabolism
    L483_27675
  Lipid metabolism
   00071 Fatty acid degradation
    L483_27675
   00072 Synthesis and degradation of ketone bodies
    L483_27675
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L483_27675
   00310 Lysine degradation
    L483_27675
   00380 Tryptophan metabolism
    L483_27675
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L483_27675
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L483_27675
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L483_27675
Enzymes [BR:pput01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L483_27675
Exosome [BR:pput04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L483_27675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGN80537
UniProt: R9V6U5
Position
5856818..5858035
Genome map
AA seq 405 aa AA seqDB search
MLGHYAHRTENNNMNDVVIVAATRTAIGSFQGALATVPAVDLGAAVIKRLLEQTGLDPAQ
VDEVILGQVLTAGAGQNPARQAAIKAGLPYSVPALTLNKVCGSGLKALHLAAQAIRCGDA
DVVIAGGQENMSLAPYVMPSARTGQRMGHGQLIDSMITDGLWDAFNDYHMGITAENLVDK
YGLSREQQDAFAAESQRKAVAAIEAGRFNDEITPIVLPQKKGEPKVFAQDEQPRPDTTAD
SLAKLRPAFKKDGSVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLAKIAAYASAGVDPA
IMGIGPVSATQRCLDKAGWQLAELDLIEANEAFAAQALAVGKVLEWDAARVNVNGGAIAL
GHPIGASGCRVLVTLLHEMIKRDAKKGLATLCIGGGQGVALAIER
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggcattacgcccatcgcacggagaacaacaacatgaatgacgtggtcatcgtc
gccgctacccgcaccgccatcggcagctttcagggcgccctggccacggtacctgcggtc
gacctcggtgccgccgtgatcaaacgcctgctggagcagaccgggctggacccggcgcag
gtcgacgaagtgatcctcggccaggtgctcaccgccggcgccggccagaacccagcgcgc
caggccgcgatcaaggccggcttgccctacagcgtaccggcactgaccctgaacaaggtc
tgcggctcgggcctcaaggcactgcacctggccgcacaggccatccgctgcggtgatgcc
gatgttgtgattgccggtggccaggaaaacatgagccttgccccctatgtgatgccttca
gcccgcactggccagcgtatgggccatggccagctgatcgacagcatgatcaccgatggc
ctgtgggatgccttcaacgactaccacatgggcatcaccgccgagaaccttgtggacaag
tacggcctgagccgtgaacagcaggacgcctttgccgccgagtcgcagcgcaaggccgtg
gcggccatcgaggccgggcgcttcaacgatgaaatcaccccgatcgtattgccgcagaaa
aaaggtgagcccaaggtgttcgcccaggacgaacagccacgcccggacaccaccgctgat
tccctggccaaactgcgtcctgcgttcaagaaggatggcagcgttaccgctggcaacgcc
tccagcctgaatgacggcgccgccgccgtgctgctgatgagtgccgccaaggccaaagcc
ctgggcctgccggtgctggcgaagatcgccgcctatgccagtgcaggggtagacccggca
atcatgggtatcggcccggtttcagcgactcagcgttgcctggacaaggccggttggcaa
ctggccgaactggacctgatcgaagccaacgaagcctttgccgcacaggcgctggcagtg
ggcaaggtgctggaatgggatgctgcgcgggtcaacgtgaatggcggggcgattgccctg
ggccacccgattggcgcttccgggtgccgggtgctggtgaccttgctgcacgagatgatc
aagcgggacgccaagaaaggcctggcgaccttgtgcatcgggggtgggcaaggcgtggcg
ctggcgatcgagcgctga

DBGET integrated database retrieval system