KEGG   Pseudomonas sp. UW4: PputUW4_00827Help
Entry
PputUW4_00827     CDS       T02357                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00350  Tyrosine metabolism
ppuu00643  Styrene degradation
ppuu01100  Metabolic pathways
ppuu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PputUW4_00827 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PputUW4_00827 (maiA)
Enzymes [BR:ppuu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     PputUW4_00827 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AFY18034
UniProt: K9NE08
Position
984935..985570
Genome map
AA seq 211 aa AA seqDB search
MELYTYYRSTSSYRVRIALALKGLDYQSLPVNLIAPQGGEHRQPPYLGINPQGRVPALRT
DEGELLIQSPAIIEYLEERYPQVPLLSRDLATRAHERGVAAVIGCDVHPLHNVSVLNRLR
QSGHDEPQVVEWIGHWVSQGLATVEQLIGDDGYCFGPEPGLADVYLIPQLYAAERFNVSL
EAYPRIRRVAALAATHPAFIQAHPANQPDTP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggaactctatacctactaccgttcgacgtcgtcgtaccgggtgcgtatcgcgttggcg
ctcaagggcctggattatcaatccctgccagtcaacctgatcgcaccccagggcggcgag
catcgacagccgccttatctgggcatcaacccacagggccgcgtgccggccttgcgtacc
gatgaaggcgagttgctgatccagtctcccgcgatcatcgaatacctggaggaacgttat
ccacaggtgccgctgctgtccagggacctcgccacccgcgcacatgagcgtggcgtggcg
gcagtgatcggctgcgatgtgcacccgctgcacaacgtcagcgtgctcaaccggctgcgc
cagtcgggccacgacgaaccgcaggtggtggagtggatcggccactgggtcagccaggga
ctggccacggtagagcagttgatcggtgatgacggttactgcttcggccccgagccgggg
ctggcggacgtctatttgatcccgcagctgtacgcggccgagcgcttcaatgtttctctt
gaggcttatccacgcattcggcgagtggcggcattggcggcgacgcatccggcgttcatc
caggcgcatccggcgaatcagccagatacgccataa

DBGET integrated database retrieval system