KEGG   Pseudomonas sp. UW4: PputUW4_02464Help
Entry
PputUW4_02464     CDS       T02357                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00071  Fatty acid degradation
ppuu00072  Synthesis and degradation of ketone bodies
ppuu00280  Valine, leucine and isoleucine degradation
ppuu00310  Lysine degradation
ppuu00362  Benzoate degradation
ppuu00380  Tryptophan metabolism
ppuu00620  Pyruvate metabolism
ppuu00630  Glyoxylate and dicarboxylate metabolism
ppuu00640  Propanoate metabolism
ppuu00650  Butanoate metabolism
ppuu00900  Terpenoid backbone biosynthesis
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01130  Biosynthesis of antibiotics
ppuu01200  Carbon metabolism
ppuu01212  Fatty acid metabolism
ppuu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputUW4_02464
   00630 Glyoxylate and dicarboxylate metabolism
    PputUW4_02464
   00640 Propanoate metabolism
    PputUW4_02464
   00650 Butanoate metabolism
    PputUW4_02464
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PputUW4_02464
   00072 Synthesis and degradation of ketone bodies
    PputUW4_02464
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputUW4_02464
   00310 Lysine degradation
    PputUW4_02464
   00380 Tryptophan metabolism
    PputUW4_02464
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PputUW4_02464
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputUW4_02464
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PputUW4_02464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppuu04147]
    PputUW4_02464
Enzymes [BR:ppuu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PputUW4_02464
Exosome [BR:ppuu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PputUW4_02464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFY19661
UniProt: K9NHU6
Position
2875700..2876893
Genome map
AA seq 397 aa AA seqDB search
MTMSNDPIVIVSAVRTPMGGFQGELKSLTAPQLGAAAIKAAVERAGVSTDSIDEVLFGCV
LPAGLGQAPARQAALGAGLDKSTRCTTLNKMCGSGMEAAILAHDMLVAGSADVVVAGGME
SMSNAPYLLDRARAGYRMGHGRVQDSMFLDGLEDAYDKGRLMGTFAEDCAETNSFSREAQ
DAFAIASTTRAQQAIKDGSFKAEIVPLTVTVGKEQVVISNDEQPPKAKLDKIASLKPAFR
EGGTVTAANSSSISDGAAALVLMRQSQAQKQGLKPLAVIHGHAAFADTPGLFPVAPIGAI
KKLMKKTGWSLNDVDLVEVNEAFAVVGMAAMTHLEIPHEKLNVHGGACALGHPIGASGAR
ILVTLLSALRQKGLKRGVAAICIGGGEATAMAVECLY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgtccaacgatccgattgtaatcgtcagcgccgtccgcaccccgatgggtggt
ttccagggcgaactgaaaagcctgaccgcaccgcaactgggtgctgccgcgatcaaagcc
gccgttgaacgtgccggcgtttccactgacagcatcgacgaagtgctgtttggctgcgtt
ctgccggccggccttggccaggcccctgcgcgtcaggcggcactgggtgccgggctggat
aaatcgacccgttgcaccaccctgaacaagatgtgcggttcgggcatggaagcggcgatt
ctggcccacgacatgctggtggctggcagtgccgacgtggtggtcgccggtggcatggaa
agcatgtccaacgcgccttacctgctggaccgtgcccgtgccggctaccgcatgggccat
ggccgggtgcaggactcgatgttcctggacggcctcgaagacgcctacgacaagggccgc
ctgatgggcaccttcgccgaagactgcgccgaaaccaacagcttcagccgggaagcccag
gacgcgttcgccatcgcctcgaccacccgtgcgcaacaggcgatcaaggacggcagcttc
aaagccgaaattgtcccgctcaccgtgacagtgggcaaagagcaggtggtgatcagcaac
gacgagcagccgccaaaagccaagctggacaagatcgcttcgttgaaaccggcgttccga
gaaggcggtacggtgacggcagccaactccagttcgatctccgacggtgcggcggcattg
gtgctgatgcgccagtcccaggcacagaaacaaggcctgaagccgctggcggtgatccat
ggccacgccgcgttcgccgacaccccgggtctgttcccggtggcgccaatcggtgcgatc
aagaaattgatgaagaaaaccggctggtcgctcaatgacgtcgatctggtggaagtcaac
gaagccttcgccgtggtcggcatggccgcgatgactcacttggaaatcccccacgagaaa
ctcaacgtgcacggcggcgcttgtgccttgggccacccgatcggggcgtccggtgcgcgg
attctcgtgaccttgctgtcggccctgcgccagaaaggcctgaagcgcggcgtcgcggcg
atctgcatcggtggcggtgaagcgacggcaatggccgtggaatgcctgtactga

DBGET integrated database retrieval system