KEGG   Pseudomonas sp. UW4: PputUW4_03077
Entry
PputUW4_03077     CDS       T02357                                 

Gene name
tssM
Definition
(GenBank) ImcF domain-containing protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu02025  Biofilm formation - Pseudomonas aeruginosa
ppuu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PputUW4_03077 (tssM)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PputUW4_03077 (tssM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuu02044]
    PputUW4_03077 (tssM)
Secretion system [BR:ppuu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputUW4_03077 (tssM)
SSDB
Motif
Pfam: IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: AFY20272
UniProt: K9NKW9
Position
complement(3612897..3616277)
AA seq 1126 aa
MQFRRSVGIGVLVSVLVVAGLVLAAQVWYHPESLGIESGSGWQTLWFSVVSATTLIVAMF
LGGYPLLGRLLGHSTYGRLDTDDVHQPAQVFPEKNVDTPGARTIAAIKASLRKRHGHLWR
HKTRLLLIVGEPEQIQAIAPGLSNDNWLEDHNTLLFWGGSVQTQLDDSVLDRCRALTRWS
ALDGVVWALNAEQSADDNLMGNGARHLQDLARTLGWSLPLHLWQVCASSWAQDQRPTQAV
GCALPSRLTPPILEHALENLLEPLRHEGWAQMSTRPDHDFLLRLSRDLQVEGLARWRQAL
APWFGGFRQDLPLRGLWFSLPLTGKTLRKDDHFWSMGPVWQGVLDAPKPHSRRLGWSAPR
VAYGLALGLAVVWGTGLLLSFATNRVQIAQVQTVLITLEQSQSADDQFLAFNELVRELAR
LDYRAEHGTPWYQRFGLNQNDALLAELWPRYVEANQRLLRDPAVAHLQARLNALVKLPPD
SPERSKRAGVAYAQLKAYLMLARPEKSDPAFLAQALSDAEPQRAGFSPGLWQGLSPTLWQ
FYAQQLARHPQWRIEADPRLVAQARQVLLGQLGQRNGETSLYQSVLDSAANHAPALNLQQ
MVGDTEATALFSTSAEVPGVFTRQAWEGQVRPAIAAIAEARREEIDWVLSDNPASLAVEL
TPDQLKERLTERYFQDYANAWLDFLNHLRWQPVDSLGEVIDQLALMSDVRQSPLIALMNT
LAWQGQAGTRGQALGESLIKSAQKLIAQDSVPPIEQSLDGPGGPLDATFGPLLSLLGKDV
ERTNDSERLSLQAFLNRVTRVRLKLQQVSNAPNPQAMTQALAQSVFQGHSVDLTDTQAYG
NLLAASLGAEWDGIGQTLFVQPLEQAWQRVLQPSTAGLNSQWQRAIVKDWHGAFVGRYPF
AATASDASLPMLGQMIRADSGRIEQFLQQQLGGVLRKEGSRWVADARHSQGLHFNPKFLT
AINQLSHLADVLYTDGGMGLSFELRGKPVRDVVQTTFILNGEKHEYFNQKERWQRFSWPG
FSQHPGTRLLWISVLANERLFGDYEGTWGLIRLLEQAKVTALNDTDSQYRVQLRAPDGLD
LTWHLRTELGAGPLALLKLRGFELPAQIFLGEGTQAQPYAQNGSYP
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgcagtttcgacgctctgtagggataggtgttttggtcagcgtgctggtggtcgctggt
ctggtgttggctgcacaggtttggtatcaccctgagtcgctaggtattgaatccggcagc
ggctggcaaaccctctggttttcggtggtctcggccaccaccttgatcgtggcgatgttc
ctgggtggttatccattgctgggacggctgttggggcattcaacttatggccggcttgat
acggatgacgttcaccagcctgcgcaagtgttcccggaaaaaaacgttgatacgccggga
gcacgaaccatcgcggcgatcaaagcttccttgcgcaagcgccacggccacctctggcgc
cacaaaacacgcctcctgctcatcgtcggcgaacccgagcagatccaggccatcgccccc
ggcctgagcaacgacaactggctggaagaccacaacaccctgttgttctggggcggcagt
gtgcaaacccaactggacgattccgtgctcgaccgctgtcgcgccttgacccgctggagc
gccctcgacggcgtggtctgggcgctgaacgccgagcagagcgccgacgacaacctgatg
ggcaacggtgcacgtcacctgcaagatctggcgcgtacgctgggctggtcgttgccgttg
cacctgtggcaggtctgcgccagttcgtgggcgcaggaccagcgcccaacccaggcggtc
ggctgcgcgctgccgtcacgcctgacgccgccgatcctggaacacgcgctggaaaatttg
ctggaaccgttgcgccacgaaggctgggcgcagatgagcacgcggcccgatcatgatttc
ctgctgcgcttgtcgcgggacttgcaggtcgaaggcctggcccgttggcgtcaggcgctt
gcgccgtggttcgggggcttccggcaggacctgccgttgcgcgggttgtggttcagcttg
ccgctgaccggtaaaacgttgcgcaaagatgatcacttctggtccatggggccggtctgg
cagggcgtgctggacgccccgaaaccgcacagccggcgcttgggttggagcgcgccgcgc
gtcgcttatgggctggcgttgggtctggccgtggtctggggcaccggactgctgctgtcg
ttcgccaccaaccgcgtgcagatcgcgcaggtgcagaccgtgttgatcaccctcgaacaa
tcgcaaagcgccgatgaccaattcctcgcgttcaacgaactggtccgcgaactggctcgt
ctggattaccgcgccgaacacggcacgccgtggtatcagcgctttggcctcaatcaaaac
gatgcgctgctggccgagctgtggccgcgttacgtcgaggccaatcagcgcttgctgcgc
gatccggcggtggcccacttgcaggcgcggctcaacgcgctggtcaaactgccgccggac
agccccgaacgcagcaagcgtgccggtgtggcctacgcgcaactcaaggcctacctgatg
ctggcgcgcccggaaaaatccgatccggcgttcctggcccaggccctgagcgacgccgag
ccgcagcgcgccgggttctcgccgggactctggcagggcctgtcgccgaccctgtggcag
ttctacgcgcagcaactggcgcgccatccgcaatggcgcatcgaagccgacccacgactg
gtggcccaggcccgccaagtactgctcggccagttgggccagcgcaatggcgaaaccagc
ctgtaccagagcgtcctcgacagcgcggccaatcacgcgccggcgttgaatctgcagcag
atggtcggcgacaccgaggcgacggcgctgttctccacatcggccgaagtgcccggcgtg
ttcacccgccaggcctgggaaggccaggtgcggccggccatcgccgccatcgccgaggcc
cggcgcgaagaaatcgactgggtgctcagcgacaatcccgccagcctcgccgtcgaactg
accccggaccagctcaaggagcgactgaccgagcgctactttcaggactacgccaacgcc
tggctggacttcctcaaccacctgcgctggcaaccggtcgacagcctgggcgaggtgatt
gatcaactggcgctgatgagcgacgtgcgccagtcgccgctgatcgcgctgatgaacacc
ttggcctggcaggggcaggccggcacgcgcggccaggccttgggcgagtcgttgatcaag
tcggcgcagaagctgatcgcccaggacagcgtgccgccgatcgagcagtcgctcgacggg
ccgggtggtccgctggacgccaccttcgggccattgctgagcctgctgggcaaggacgtc
gagcgcaccaacgacagcgagcgcctgagcctgcaagccttcctcaaccgcgtcacccgg
gtgcgactgaagctgcaacaagtgagcaacgcgccgaacccgcaggctatgactcaagcc
ctggcgcagagcgtgttccagggtcacagcgtcgacctcaccgacacccaggcctacggc
aacctgctcgccgccagcctcggcgccgagtgggacgggatcggccagaccctgttcgtg
cagccgctggagcaggcctggcaacgggtgctgcaaccctcgacggcgggcctcaacagc
cagtggcagcgggcgatcgtcaaggactggcacggcgccttcgtcggtcgctaccccttc
gcggccaccgccagcgacgcctcgctgccgatgctcgggcaaatgatccgcgccgactcc
gggcgcattgaacagtttctgcaacagcaactgggcggtgtgctgcgcaaggaaggcagc
cgctgggtggccgacgcgcggcacagccagggtctgcacttcaacccgaagttcctgacg
gcgatcaaccagctcagccacctcgccgacgtgctctacaccgacggcggcatgggcctg
agtttcgagctgcgcggcaagccggtgcgcgacgtggtgcagaccactttcatcctcaac
ggcgaaaagcatgagtacttcaaccagaaggaacgctggcagcgcttcagctggccgggc
ttcagccagcatccgggcacgcgtttgttgtggatcagtgtgctggccaatgaacggctg
ttcggcgactacgaaggcacctggggcctgatccgcctgctggaacaagcgaaagtcacc
gcgctgaacgacaccgacagccagtatcgcgtgcagctcagggcacctgatggcctcgac
ctgacctggcacctgcgcaccgaactgggcgcagggccgctggcgctgctcaagttgcgc
ggctttgaattgccggcgcagatttttctcggcgagggcactcaagcgcagccttatgcg
cagaacggaagttacccatga

DBGET integrated database retrieval system