KEGG   Pseudomonas sp. UW4: PputUW4_03089Help
Entry
PputUW4_03089     CDS       T02357                                 

Gene name
tssC
Definition
(GenBank) EvpB family type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PputUW4_03089 (tssC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuu02044]
    PputUW4_03089 (tssC)
Secretion system [BR:ppuu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputUW4_03089 (tssC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AFY20284
UniProt: K9NKK5
Position
complement(3631174..3632712)
Genome map
AA seq 512 aa AA seqDB search
MSIEHSHAQSRGTTVLPEESQGVYGALFGKINLNPVKVLGEIEVFQSSEALSDVSADERV
TAAVSVFLNLIKQSSRKVRRLDRTLLDEHIASLDAQISRQLDAVMHHPDFQRVESTWRGV
KSLIDQTDFRQNVRIELLDISKDHLVQDFEDAPEIAQSGLYVHTYTQEYDTPGGEPIAAA
ISNFEFDRSPQDIALLRNISKVSAAAHMPFIGSVGPAFFGKHSMEEVAAIKDIGNYFDRA
EYIKWKAFRDSDDARYIGLLMPRVLGRLPYGPDTVPVRSFNYIESVKGPDHDKYLWTNAS
FAFAANMVKSFIANGWCVQIRGPQSGGAVTDLPIHLYDLGTGNQVKIPSEVMIAETREFE
FANLGFIPLSYYKNRDYACFFSANSTQKPALYDTPEATANSRINARLPYIFLLSRIAHYL
KLIQRENIGTTKDRRLLELELNKWVSGLVTEMNDPGDSLQASHPLRAGRVTVEDIEDNPG
FFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaacattctcacgcgcaatcgcgcggcactacagtgttgcctgaagaaagc
caaggcgtgtatggcgcgttgtttggcaagatcaatctcaacccggtaaaagtgctgggc
gaaattgaagtgtttcaaagttccgaggcgctgtcggacgtttctgccgatgagcgagtg
actgccgctgtcagtgttttcttgaatttgatcaaacagtcttcgcgcaaagtccggcgt
ctggacaggacactgctggatgaacatattgcgtcgctggatgcacaaatcagccgccaa
ctggacgccgtgatgcatcacccggatttccagcgggtggagtccacctggcgcggtgtg
aaatcgctgatcgatcagaccgacttccgccagaacgtgcgcatcgaattgcttgatatc
agcaaggatcacctggtccaggatttcgaggatgcaccggagatcgcacaaagtggcctg
tatgtgcatacctacacccaggagtacgacaccccgggtggtgagccgatcgccgctgcc
atttccaacttcgagttcgaccgcagcccgcaggacattgccttgctgcgcaatatttcc
aaagtctcggcagccgcgcacatgcccttcattggctccgtcggcccggccttttttggc
aagcactcgatggaagaagtcgccgccatcaaggacatcggcaactactttgatcgtgcc
gaatacatcaagtggaaagcgttccgcgacagcgacgatgcccgctatatcggcttgctc
atgccccgcgtgctgggccgtctgccgtatggcccggacaccgttccggtgcgcagcttc
aactacatcgaaagcgtcaagggaccggaccacgacaaatacctgtggaccaacgcctcg
tttgccttcgctgccaacatggtcaagagctttatcgccaacggctggtgcgtgcagatc
cgcggtccgcagtctggcggcgcggtcaccgacttgccgatccacttgtatgatctgggc
actggcaatcaggtgaagatcccttcggaagtgatgattgcggagacgcgcgagttcgag
ttcgccaacctcggtttcatcccgctctcgtactacaagaaccgtgactatgcgtgcttc
ttctcggccaactccacgcagaaaccggcgctatacgatacccctgaggccaccgccaat
agccggatcaatgcgcgcctgccctacatcttcctgctgtcacgcattgcccattacctg
aagctgatccagcgcgaaaacatcggcaccaccaaggatcgccgattgctggagctggag
ctgaacaagtgggtcagcgggctggtcaccgagatgaacgatccgggcgactcgctgcag
gcttcgcacccgttgcgggctggccgggtcaccgtcgaagacatcgaggacaacccgggt
ttcttccgcgtcaagttgtacgccgtgccgcatttccaggtggaaggcatggacgtcaac
ctgtcgctggtttcgcagatgcccaaggcaaaagcctga

DBGET integrated database retrieval system