KEGG   Pseudomonas sp. UW4: PputUW4_03767Help
Entry
PputUW4_03767     CDS       T02357                                 

Gene name
cobC1
Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00860  Porphyrin and chlorophyll metabolism
ppuu01100  Metabolic pathways
Module
ppuu_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PputUW4_03767 (cobC1)
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     PputUW4_03767 (cobC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFY20959
UniProt: K9NMH9
Position
complement(4361572..4362147)
Genome map
AA seq 191 aa AA seqDB search
MTLRVDLLRHGETEFGGGLRGSIDDALTDTGWAQMRAAVVGQGPWDRLVSSPLQRCARFS
EELGAQLGVPVQLDKDLQELHFGAWEGQSAAALMETDAQALGLFWADPYSFTPPQGEPVA
GFSTRVLAALERLHATCAGERILLISHGGVMRLLLAQARGLPREQLLNVEVGHGALFSLT
MESDGLLKEVL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgtggatctgttgcgtcacggtgaaaccgaattcggcggtggcctgcgc
ggcagcatcgatgatgccttgaccgacacgggatgggcgcagatgcgcgccgccgtggtc
gggcaggggccatgggaccggttggtcagttcgccgttgcagcgttgtgcgcggttttcc
gaggaactcggtgcacaactgggtgtaccggtgcagttggataaagacctgcaagagttg
catttcggtgcctgggaagggcagagcgcggcggcgttgatggaaaccgacgcgcaggcg
ctcggcttgttctgggccgatccttactcgttcacgccgcctcagggtgagccggttgca
ggcttttcgacacgggtattggcagcgctggagcgtttgcacgcgacctgtgccggtgag
cgcattctgctgatcagccacggcggggtgatgcgcctgttgctggcacaagctcgcggg
ctgccgcgagagcagctgctcaacgttgaggtcgggcatggcgcactgttttcgctgacg
atggagtccgatggtttgttgaaggaagtgctttga

DBGET integrated database retrieval system