KEGG   Pseudomonas sp. UW4: PputUW4_04088Help
Entry
PputUW4_04088     CDS       T02357                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ppuu  Pseudomonas sp. UW4
Brite
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PputUW4_04088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AFY21280
UniProt: K9NPV2
Position
complement(4701162..4701821)
Genome map
AA seq 219 aa AA seqDB search
MIDLYTAATPNGHKVSIVLEELGLPYRVHALSFDKKEQKSADFLKINPNGRIPAIVDRAN
GDFAVFESGAILIYLAEQTGKLMPSDPKGRSLVLQWLMFQMGGIGPMQGQANVFFRYFPE
KLQGAIDRYQHETRRLYEVLDTRLQSVEFLAGEYSIADIATFPWVRGYEWSGVSVEGLTA
LQRWMATLEARPAVQCGLQVPQRADEASVIKGAQAMLIR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatagatctctacaccgctgcgaccccgaatggccacaaggtctctatcgtgctcgag
gaactcggcctgccctacagggtgcatgccttgagtttcgacaagaaggagcagaagtcc
gcggacttcctcaagatcaaccccaatggccggattccggcgattgtcgaccgcgccaac
ggcgatttcgctgtgttcgagtccggcgccatcctgatctacctcgcagaacagactggc
aaactgatgccgagcgacccgaaggggcgttcgctggtgttgcagtggctgatgttccag
atggggggcatcggcccgatgcagggccaggccaacgtatttttccgctactttccggaa
aaactccagggcgccatcgaccgctatcagcatgaaacccgtcgcctctacgaagtgctc
gacacgcgtttgcaaagcgtggagttcctcgccggcgagtacagcattgccgacatcgct
acctttccctgggtgcgcggttacgagtggtcgggcgtctcggtggagggcttgacagcg
ttgcaacgctggatggcaaccctggaggcccgaccggcggtacagtgtggtctgcaggta
ccgcaacgcgccgatgaagccagtgtcatcaagggcgcccaggccatgctgatccgatga

DBGET integrated database retrieval system