KEGG   Pseudomonas sp. UW4: PputUW4_04990Help
Entry
PputUW4_04990     CDS       T02357                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00620  Pyruvate metabolism
ppuu00630  Glyoxylate and dicarboxylate metabolism
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputUW4_04990 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PputUW4_04990 (glcB)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PputUW4_04990 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFY22180
UniProt: K9NSD9
Position
5697340..5699517
Genome map
AA seq 725 aa AA seqDB search
MTEHVQVGGLQVAKVLFDFVNNEAIPGTGLTADKFWAGADKVIHDLAPKNKALLAKRDDF
QARIDSWHQERAGQAHDAVAYKAFLQDIGYLLPEAADFQATTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEANGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLAAGSHVDSTGYKIVDGKLVVALKGGSNTGLRNDAQLIGFQGDAAAPTAILLKNNGLHF
EIQVDASTPVGQTDAAGVKDILMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
SEDVAKGGQTFTRTMNADRTYTAVDGSELSLHGRSLLFVRNVGHLMTIDAILDKDGNEVP
EGILDGLVTCLSAIHNLNGNSSRKNSRTGSVYIVKPKMHGPEEAAFTNELFGRIEDVLGL
PRNTLKVGIMDEERRTTINLKACIKAASERVVFINTGFLDRTGDEIHTSMEAGPMVRKAD
MKAEKWIGAYENSNVDIGLSTGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAKRAHASVDDILTIPLAVNPQWTAEQIKNELDNNS
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHGIVTEEQVMESL
KRMAPVVDRQNAGDALYRPLAPNFDSNIAFQAAVELVVEGTKQPNGYTEPVLHRRRREFK
AANGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aacaacgaagccattcccggtaccggcctcaccgccgataagttctgggccggtgccgac
aaggtcatccatgacctggccccgaagaacaaagccctactcgccaaacgcgatgatttc
caggctcgtattgattcctggcaccaggaacgcgccggtcaggcgcacgacgccgtggcc
tataaagccttcctgcaagacatcggttatctgctgccagaagcggccgatttccaggca
acgacgcaaaacgtcgatgacgaaatcgcccgcatggccggcccgcagctcgtggtgccg
gtgatgaacgcccgcttcgcgctcaacgcctcgaacgcccgctggggttcgctgtacgac
gcgctctacggcaccgacgccatcagcgaagccaacggtgcggaaaaaggcaaaggctac
aacaaggtgcgcggtgacaaggtcatcgccttcgcccgtgccttcctcgacgaagcggcg
ccattggcggccggctcccacgtcgattccactggctacaagatcgtcgatggcaaactg
gtggttgccctcaaaggcggcagcaacaccggcctgcgcaacgacgctcaactgatcggc
ttccagggcgatgccgcggcaccaaccgcgatcctgctgaaaaacaacggcctgcatttc
gaaatccaggtcgacgccagcaccccggtcggccagaccgacgcggctggcgtcaaagac
atcctgatggaagccgcactgaccaccatcatggactgcgaagactcggttgccgccgtc
gacgccgatgacaaagtggtgatctaccgcaactggctcggcctgatgaagggcgatctg
tcggaagacgtcgccaagggcggtcagacctttacccgcaccatgaacgccgaccgcacc
tacaccgcggtcgatggcagcgaactgagcctgcacggtcgttcgctgctgttcgtgcgt
aacgttggtcacctgatgaccatcgacgcgatcctcgacaaagatggcaatgaagtgccg
gaaggcattctcgatggcctggtgacctgcctgtcggcgatccacaacctcaacggcaac
agctcgcgcaagaacagccgcaccggctcggtctatatcgtgaagccgaagatgcacggc
cctgaagaagccgcgttcaccaatgagttgttcggtcgcatcgaagacgtgctgggcctg
ccacgcaataccctgaaagtcgggatcatggacgaggagcgtcgtaccacgatcaacctc
aaggcctgcatcaaggcggcgagcgagcgcgtggtgttcatcaacaccggtttcctcgac
cgcacgggcgatgaaatccacacctccatggaagccggcccgatggtgcgcaaggcggac
atgaaggcggaaaaatggatcggcgcctacgagaactccaacgtcgatatcggtctgagc
accggcctgcaaggtcgcgcgcagatcggtaaaggcatgtgggcgatgccggacctgatg
gcagcgatgctcgaacagaaaatcgctcacccgctggccggtgccaacactgcctgggta
ccttcgccgaccgccgctgcactgcatgcactgcactaccacaaggttgacgtgttcgcc
cgtcaggccgaactggccaaacgtgcccatgcatcggtagacgacatcctgaccatcccg
ctggcggtgaacccgcagtggaccgccgaacagatcaagaacgaactggacaacaatagc
cagggcattctcggttacgtggtgcgctggatcgaccagggcgtcggttgttcaaaagtg
ccggacatcaatgacgtcggcctgatggaagaccgtgccacgctgcgtatttccagccag
cacatcgccaactggctgcgccatggcatcgtcaccgaagagcaggtaatggaaagcctc
aagcgcatggcgccggtggttgaccggcaaaacgccggcgacgcgctgtaccgtccgctg
gccccgaacttcgacagcaacatcgccttccaggcggcggtcgaactggtggtcgaaggt
accaaacagccgaacggctacaccgagccggtcctgcaccgtcgtcgtcgcgagttcaag
gccgccaatggcctgtaa

DBGET integrated database retrieval system