KEGG   Pseudomonas sp. UW4: PputUW4_05079Help
Entry
PputUW4_05079     CDS       T02357                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00670  One carbon pool by folate
ppuu01100  Metabolic pathways
ppuu01120  Microbial metabolism in diverse environments
ppuu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PputUW4_05079 (metF)
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     PputUW4_05079 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AFY22269
UniProt: K9NRA8
Position
5800580..5801425
Genome map
AA seq 281 aa AA seqDB search
MSQDRRYSFEFFPTKTDAGQEKLLATARQLATYNPDFFSCTYGAGGSTRDRTLNTVLQLE
SEVKIPAAPHLSCVGDSKADLRGLLAQYKAAGIKRIVALRGDLPSGMGMASGEMRHANDL
VEFIREETGDHFHIEVAAYPEMHPQARNFEDDVANFVRKANAGADSAITQYFFNADCYFY
FVERVRALGVDIPIVPGIMPITNYSKLARFSDACGAEIPRWIRKQLEAYGDDTQSIQRFG
EQVITEMCEQLLQGGAPGLHFYTLNQAEASLAVWNNLKLPR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaagatcgtcgctacagcttcgagttcttccctacgaagaccgatgctgggcaa
gaaaagctgctcgccactgctcgccagctggccacctacaaccccgatttcttctcctgc
acctacggcgccggcggttcgacccgtgatcgcacgctgaacaccgtgttgcagctggaa
agtgaagtcaaaatccctgccgctccgcacctttcctgcgtgggcgacagcaaagccgac
ctgcgcggcctgctggcccagtacaaggccgccggcatcaagcgcatcgttgccctgcgc
ggtgacctgccctcgggcatgggcatggccagtggcgaaatgcgccacgccaatgacctg
gttgagttcattcgtgaagaaaccggcgaccatttccacatcgaagtcgccgcctacccg
gaaatgcatccgcaagcgcgcaacttcgaagacgatgtcgccaacttcgtgcgcaaggcc
aacgccggcgccgacagcgcgatcacccagtacttcttcaacgccgactgctacttctac
ttcgtggaacgcgtgcgggcattgggcgtggacatcccgatcgtgccgggcatcatgccg
atcaccaactacagcaagctggcgcgcttctccgatgcctgcggtgcggaaatcccccgc
tggatccgcaagcaactggaagcctacggcgacgacacccagagcattcagcgctttggc
gaacaggtcatcaccgagatgtgcgaacaactgctgcaaggtggcgctccagggctgcac
ttctacacgctgaaccaggctgaagcgagcctggcggtgtggaacaacctaaagttgccg
cgttaa

DBGET integrated database retrieval system