KEGG   Pseudomonas sp. UW4: PputUW4_05417Help
Entry
PputUW4_05417     CDS       T02357                                 

Gene name
gstA
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PputUW4_05417 (gstA)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PputUW4_05417 (gstA)
Transporters [BR:ppuu02000]
 Other Transporters
  Pores ion channels [TC:1]
   PputUW4_05417 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AFY22606
UniProt: K9NRB8
Position
complement(6155867..6156493)
Genome map
AA seq 208 aa AA seqDB search
MQAIKLYNFPRSGHAHRVELMLSLLKLPTELIFVDLAKGEHKQPAFLALNAFGQVPVIDD
EGVVLADSNAILVYLAQKYGNGRWLPADPVGAAKVQRWLSVAAGPIAFGPARARLITVFG
APYNAEEVIAYAHTVLKVIDHELADTAYLVGTEPTIADVAAYSYIAHAPEGNVSLDEYPN
IRAWLARIEALPGFVGMPRTVAGLQKTA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgatcaaactctacaacttcccacgttccggccacgcgcatcgtgtcgagttg
atgctgtccctgctgaaattgccgaccgaattgatcttcgttgaccttgccaagggcgaa
cacaagcaaccggcgttcctggcgctcaatgcattcggtcaggtgccggtgattgatgac
gagggtgtggtattggccgattccaacgcgattctggtgtacctggcgcaaaagtacggc
aacggccgttggttgccggctgatccggtgggggcggccaaagtccagcgctggttgtcg
gtggctgctggcccgattgccttcggtccggcccgggccagattgatcactgtatttggt
gcgccttacaacgctgaagaagtgattgcctacgcccataccgtgctcaaagtgatcgat
cacgaactggccgatacagcgtatctggtcggcaccgaaccgacgattgccgacgtcgcc
gcctacagctacatcgcccatgcgccggagggcaatgtgtcgctggacgagtaccccaat
attcgcgcgtggctggcccgtatcgaagccttgccaggttttgtcggcatgccgcgtacc
gtcgctggcctgcaaaaaactgcctga

DBGET integrated database retrieval system