KEGG   Pseudomonas parafulva: NJ69_03330Help
Entry
NJ69_03330        CDS       T03520                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00071  Fatty acid degradation
ppv00410  beta-Alanine metabolism
ppv00592  alpha-Linolenic acid metabolism
ppv00640  Propanoate metabolism
ppv01040  Biosynthesis of unsaturated fatty acids
ppv01100  Metabolic pathways
ppv01110  Biosynthesis of secondary metabolites
ppv01200  Carbon metabolism
ppv01212  Fatty acid metabolism
Module
ppv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NJ69_03330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NJ69_03330
   00592 alpha-Linolenic acid metabolism
    NJ69_03330
   01040 Biosynthesis of unsaturated fatty acids
    NJ69_03330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NJ69_03330
Enzymes [BR:ppv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     NJ69_03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_1 Acyl-CoA_dh_2 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: AIZ32120
UniProt: A0A0A7JKV8
Position
749251..751065
Genome map
AA seq 604 aa AA seqDB search
MTHPSTAQARDELRDLLFAGTFESHHQSIRDALFDPVFDPRQGLNLEQAGRLAYARSRHV
HAALERPLQILANPRRLFALAEWPSLLDVASFSLLMVHYNLCLGTVYDHAHGRQDIAELT
EALDVLTSFGPYMATELGYGNNVAALETEAVYDPQSQTFTLNTPGAHAQKYMSYSGFGDI
PKVATVMARLKIDGKDLGVFPFLIRLSTEAGLCPGIRAALCPEKPVQGLDNGLTWFDNVR
VPRSSLLHGDMGHFADDGRFVLGSGNARARFLRAMSRIIPGRLCVASAGLGASRASLYIA
LRYGQQRLTNAPGTNGMPVIEYRSYQRPMFSALASAYAMTLLLNEAKARFLACEDEPSAE
VVSLINITKALATWDASAVIAECRERCGAQGIFSTNRIADYGSLLQGLVTAEGDNLVLLG
TVAGQLLAQDWQGDEPARPGRVSNLAEPEWLIAALAYREHQLWQTIREDMAGDERGYFEA
WNDAMNPGLALARLRGERIALEQLWGASLHACQDQTKAALAALASLYGLNLLQRDAAWFL
AHDRIDAGQALSLEGVIDRQCAVVRPHVATLIDGFALSPELLRAPIAQDDYIQAFCKEVN
ANVD
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgacccacccaagcactgcgcaggcgcgcgacgagcttcgcgacctgctgttcgctggt
acctttgaaagccaccatcagagcatccgtgatgcgctgttcgaccctgtcttcgaccca
cgccaaggcttgaatctcgagcaggccgggcgcctggcctatgcccgcagtcggcatgtg
catgcggcgctggagcgcccactgcagatcctggccaacccgcgtcgcctgttcgccctg
gcggaatggccgagcctgctggatgtcgccagcttctccttgctgatggtccattacaat
ctgtgcctaggcacggtgtacgaccatgcgcacgggcgccaggacatcgccgagcttacc
gaggcgctcgacgtgctcacctcgtttggcccctacatggccaccgagctgggctacggc
aacaatgtcgcggcgctggaaacagaagctgtctacgacccgcagagccagaccttcacg
ctcaacacaccgggtgcgcacgcgcagaagtacatgtcctacagtggctttggcgacatc
cccaaggtcgccacggtcatggccaggctcaagatcgatggcaaggacctgggcgtcttc
cccttcctaatcaggttgtcgactgaagcagggctgtgcccgggtatccgcgccgcgctg
tgcccggagaagcccgtgcaggggctggacaatggcctgacctggttcgacaacgtccgg
gtgccccgcagcagccttttgcacggggacatgggccacttcgccgatgatggccgcttc
gtgctcggctccggcaatgcccgggcccgcttcctgcgcgccatgtcgcgaatcatcccc
ggtcgcctttgcgtggccagtgccggccttggcgccagccgggccagcctctacattgca
ttgcgctatggccagcagcgcctgaccaacgcgccggggaccaacggcatgccggtcatc
gaataccgcagctaccagcgcccgatgttctcggccctggccagcgcctacgcgatgacc
ttgctgctcaacgaagccaaggcgcgcttcctggcctgcgaggatgagccctcggccgaa
gtggtcagcctgatcaatatcaccaaggccctggcgacctgggacgccagcgccgtgatc
gccgagtgccgcgagcgttgtggcgcgcaaggcatcttcagcaccaaccgcatcgctgac
tacggctcgctgctgcaagggctggtgacggccgaaggcgacaacctggtgctgctgggg
accgtcgccggccagctcctggctcaggattggcagggtgacgagccggcacggccaggc
cgggtgagcaatctggccgaaccagagtggttgatcgcggcactggcctaccgtgagcat
cagctctggcagaccatccgcgaggacatggcgggcgacgagcgcggttacttcgaggcc
tggaacgatgccatgaaccccgggctggcgcttgcccgcctgcgtggcgagcggatcgcc
ctggagcagctgtggggcgcgtccttgcatgcctgtcaggaccagaccaaggcagcgctg
gcagcgctcgccagcctctacgggcttaacctgctgcagcgcgacgctgcctggttcctg
gcccacgatcggatcgatgccggccaggcgctgtcgctggagggtgtgatcgatcgccag
tgtgcggtggtccgtccgcatgtggcgacgctgatcgatggcttcgccttgtcgcccgaa
ctactgcgcgcccccatcgcgcaggacgattacatccaggcattctgcaaggaggtcaac
gccaatgtcgactga

DBGET integrated database retrieval system