KEGG   Pseudomonas parafulva: NJ69_05755Help
Entry
NJ69_05755        CDS       T03520                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00350  Tyrosine metabolism
ppv00360  Phenylalanine metabolism
ppv00380  Tryptophan metabolism
ppv01100  Metabolic pathways
ppv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NJ69_05755
   00360 Phenylalanine metabolism
    NJ69_05755
   00380 Tryptophan metabolism
    NJ69_05755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppv04147]
    NJ69_05755
Enzymes [BR:ppv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     NJ69_05755
    4.1.1.105  L-tryptophan decarboxylase
     NJ69_05755
Exosome [BR:ppv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NJ69_05755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DUF1148 SepSecS
Motif
Other DBs
NCBI-ProteinID: AIZ32542
UniProt: A0A0A7JJC3
Position
1298733..1300157
Genome map
AA seq 474 aa AA seqDB search
MTPEQFRQHGHQLIDLIADYRQRVGEHPVMAQVEPGYLKAALPEQAPQQGEPFAAILDDV
LQQVMPGLSHWQHPDFYGYFPSNGTLSSVLGDFLSTGLGVLGLSWQSSPALSELEEVTLD
WLRQLLGLSPQWSGVIQDTASTSTLVALISARERSSGYALARGGLQSQDKPLIVYVSAQA
HSSVDKAALLAGFGRDNIRQIPTDEHFALRPEALQAAIDQDLAAGNQPCAVVATLGTTAT
TALDPLRGIGDIAQARGVWLHVDAAMAGSAMILPECRWMWDGIELADSLVVNAHKWLGVA
FDCSLYYVRDPQHLIRVMSTNPSYLQSSVDDEVKNLRDWGIPLGRRFRALKLWFMLRSEG
VEALQQRLRRDLDNARWLAEQVGAAPDWELLAPVQLQTLCLRHRPATLDGDALDAHTRGW
ADRLNASGKAYVTPATLDGRWMVRVSVGALPTERANVERLWANLQAVVEAPVRG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccgaacaattccgtcagcacggccaccagctcatcgacctgatcgccgattac
cgccagcgcgttggcgagcatccggtgatggctcaggtcgagccgggctacttgaaggcg
gcgctgcccgagcaagcgccacaacaaggcgagcctttcgccgcgattctcgacgatgtg
ctccagcaggtgatgcctggcctctcccattggcagcatccggatttctacggctacttc
ccgtccaatggcacgttgtcgtcggtactcggcgattttctcagcaccggtctaggcgtc
ttgggcttgtcctggcaatccagcccggccttgagcgagctggaggaagtcacgctcgac
tggctgcgccagttgttgggcctgtcgccgcagtggagtggggtgatccaggacaccgcc
tcgaccagcaccttggtcgcgctgatcagtgcccgtgaacgcagtagcggctatgccttg
gcccggggcggtctgcaaagccaggacaaaccgttgatcgtgtacgtcagcgcccaagcc
cacagctcagtggacaaagcggcgctgctggccggcttcggccgtgacaacatccgccag
atcccgaccgacgagcacttcgcgctgcgtcccgaggcgctgcaagcggccatcgatcag
gacctggctgccggcaatcagccctgcgcggtggtcgctaccctcgggactaccgcgacc
accgcactggacccgctgcggggcatcggtgacatcgcccaggcgaggggcgtatggctg
catgtcgatgcggcgatggccggctcggcgatgatcctgccggagtgccgctggatgtgg
gacggcatcgagctggctgattcgctggtggtcaatgcgcacaaatggctgggggtggct
ttcgactgctcgctgtattacgtgcgcgatccacagcacctgatccgggtgatgagtacc
aaccccagctacttgcagtcgtcggtggacgatgaggtgaagaacctgcgcgactggggc
ataccgctgggccggcgcttccgtgccctgaagctgtggttcatgttgcgcagcgaaggg
gtcgaggcgttgcagcagcgcttgcgccgcgacctggacaacgcccgttggctggctgag
caggtcggcgccgcgccagactgggaactgctggcgccggtgcagttgcagaccctatgc
ttgcgccaccgtccggcgacgctggacggcgatgctctggacgcgcatacgcgcggctgg
gcggaccggctcaatgcctcgggcaaggcctatgtcacccccgcgaccctggacggccgc
tggatggtgcgggtgtcggtcggcgcgttgccgaccgaacgggcgaatgtcgagcgtctt
tgggcgaacctgcaggcggtggtggaggcccctgtcaggggctga

DBGET integrated database retrieval system