KEGG   Pseudomonas parafulva: NJ69_09775Help
Entry
NJ69_09775        CDS       T03520                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00071  Fatty acid degradation
ppv00072  Synthesis and degradation of ketone bodies
ppv00280  Valine, leucine and isoleucine degradation
ppv00310  Lysine degradation
ppv00362  Benzoate degradation
ppv00380  Tryptophan metabolism
ppv00620  Pyruvate metabolism
ppv00630  Glyoxylate and dicarboxylate metabolism
ppv00640  Propanoate metabolism
ppv00650  Butanoate metabolism
ppv00900  Terpenoid backbone biosynthesis
ppv01100  Metabolic pathways
ppv01110  Biosynthesis of secondary metabolites
ppv01120  Microbial metabolism in diverse environments
ppv01130  Biosynthesis of antibiotics
ppv01200  Carbon metabolism
ppv01212  Fatty acid metabolism
ppv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NJ69_09775
   00630 Glyoxylate and dicarboxylate metabolism
    NJ69_09775
   00640 Propanoate metabolism
    NJ69_09775
   00650 Butanoate metabolism
    NJ69_09775
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NJ69_09775
   00072 Synthesis and degradation of ketone bodies
    NJ69_09775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NJ69_09775
   00310 Lysine degradation
    NJ69_09775
   00380 Tryptophan metabolism
    NJ69_09775
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NJ69_09775
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NJ69_09775
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NJ69_09775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppv04147]
    NJ69_09775
Enzymes [BR:ppv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NJ69_09775
Exosome [BR:ppv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NJ69_09775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIZ33251
UniProt: A0A0A7JLJ4
Position
complement(2303846..2305039)
Genome map
AA seq 397 aa AA seqDB search
MALANDPIVIVSAVRTPMGGLQGDLKSLTAPQLGSAAIRAAVERAGLQPDSVEQVLFGCV
LPAGLGQAPARQAALGAGLDKRTTCTTLNKMCGSGMQAAILAHDLVSAGSAEVVVAGGME
SMSNAPYLLDKARAGYRMGHGRILDHMFLDGLEDAYDKGRLMGTFAEDCAQANGFDRQAQ
DAFAIDSLTRAQAAIDHGRFADEIVAVEVTDGKQKRLVEHDEQPPKARLDKIAQLKPAFR
DGGTVTAANASSISDGAAALVMMRRSEAEKRGLRPLAVIHGHAAFADSPALFPTAPIGAI
ERLVERTGWRLAEVDLFEINEAFAVVTLAAMKHLDLPRDKVNIHGGACALGHPIGASGAR
ILVTLLWALRQNNLRRGIAAICIGGGEATAMAVECLY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgccaacgatcccatcgtcatcgtcagtgccgtgcgcacgcccatgggcggg
ctgcagggcgatctgaagagcctcacggcgccgcagttgggcagtgccgcgatccgcgcc
gccgtggagcgcgccggcctgcaacccgacagtgtcgagcaggtgctgttcggctgcgta
ctgccggccgggctcggccaggccccggcgcgacaggctgccctgggcgccggtctggac
aagcgcaccacctgcaccaccttgaacaagatgtgtggctctggcatgcaggcggccatt
ttggcccacgacctggtgtcggccggcagtgccgaggtggtggtggccggtggcatggaa
agcatgagcaacgcgccgtatttgctggacaaggcgcgggccggttaccgcatggggcat
ggccggatcctcgaccacatgttcctcgacggtctggaggacgcctacgacaagggccgt
ttgatgggcaccttcgccgaggactgcgcccaggccaacggcttcgatcgccaggcgcag
gatgccttcgccatcgactcgctgacccgtgcacaagcggcgatcgatcacggccgtttc
gctgatgagatcgttgcggtggaggtgaccgacggcaaacagaaacgtctggtggagcac
gacgagcagccgcccaaggcgcgtctggacaagatcgctcagctcaagccagcctttcgc
gacggcggtacggtcacggcggcgaacgccagttccatttccgacggcgcagcggcgctg
gtgatgatgcgtcgcagcgaggccgagaaacggggcctgcgaccgctggcagtgatccac
gggcatgcggcgtttgccgacagtccggcgctgtttcccaccgcgccgatcggggccatc
gagcggctggtcgaacgcaccggctggcgcctggccgaggtggacctgttcgagatcaac
gaagcctttgccgtggtgacgctcgcggccatgaagcatctggacctgccccgcgacaag
gtcaatatccatggcggcgcctgtgccctgggtcaccccatcggcgcgtcgggcgcgcgc
attctggtgaccctgctctgggcgttgcgccagaacaacctgcgccgcggcatcgcggcc
atctgcatcggcggcggcgaagccacggcgatggcggtcgaatgcctgtactga

DBGET integrated database retrieval system