KEGG   Pseudomonas parafulva: NJ69_12200Help
Entry
NJ69_12200        CDS       T03520                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00480  Glutathione metabolism
ppv00590  Arachidonic acid metabolism
ppv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    NJ69_12200
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NJ69_12200
Enzymes [BR:ppv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NJ69_12200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AIZ33691
UniProt: A0A0A7JMU8
Position
complement(2861869..2862417)
Genome map
AA seq 182 aa AA seqDB search
MRLRWLAVPLAFTAVASSWAADCPALLQGSLPELRGKGQVDLCQRYAGKPLVVINTASYC
GFAPQFEGLEATYKAYHDQGLEMLGVPSNDFKQEDADSEKTAKVCYANYGVTFTMTKTQA
VRGDDAIPLFAELARQSSAPKWNFYKYVVDRRGKVIGQFSSLTKPDDPAFVGAIEKAIGS
RP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttcgctggcttgcagtgcccttggcctttacggctgtcgcctccagttgggcg
gccgactgtccagcgttgttgcagggtagcctgccggaattgcggggcaaggggcaggtg
gatctttgccagcgctatgcgggcaaaccgctggtggtgatcaatacggccagctattgc
gggttcgctccgcagttcgaaggattggaggcgacctataaggcctatcatgaccagggt
ttggaaatgctgggagtgccctccaatgatttcaaacaggaagacgctgatagcgagaaa
acggccaaggtgtgttatgccaattatggcgtgacctttaccatgaccaagactcaggcg
gtgcggggggatgatgccattccgttatttgctgagttggccaggcagagtagtgcgccg
aagtggaatttctataagtatgtggtggatcgtcgggggaaggtgattgggcagttttcc
agtctgactaaaccggatgatccggcgtttgttggggctattgagaaggcgattgggtct
aggccttag

DBGET integrated database retrieval system