KEGG   Pseudomonas putida W619: PputW619_3930
Entry
PputW619_3930     CDS       T00675                                 
Name
(GenBank) NLP/P60 protein
Organism
ppw  Pseudomonas putida W619
SSDB
Motif
Pfam: Prok-JAB NLPC_P60 CHAP
Other DBs
NCBI-ProteinID: ACA74410
UniProt: B1JCY4
Position
complement(4364204..4364959)
AA seq 251 aa
MRKHILAAVQVHAAAEYPRECCGLIIAVGRSRRYLPCDNIATDPSEEFRISPEQYAAAED
QGKVIGIVHSHPDATSRPSPRDLAMCEATGLPWYILSWPEGDLRTITPTGHTPLLGRPFV
HGAWDCWQVCADWYKREWGLDFPAYAREEGWWEQADGPSLYEQTYEAAGFYQVSQPQRGD
MIVMSVGRTAHPNHAGIYLGADARLPVEAAEVFGPGPFMLHHLLGRPSEIVVFGGPWLDR
TRLVLRHRDAK
NT seq 756 nt   +upstreamnt  +downstreamnt
atgcgcaaacacatcctcgccgccgtgcaagtgcacgctgcggcagagtatccgcgcgag
tgctgcgggttgatcatcgccgtgggccgctcccggcggtacctaccatgcgacaacatc
gcgaccgacccgtccgaggagttccgtatctccccagagcagtatgcggcagccgaagac
cagggcaaggtaatcggcattgtgcactcgcaccctgacgcgaccagcaggccttcgccg
cgcgacctcgcgatgtgcgaggcaacggggttgccctggtacatcctgtcgtggccagag
ggcgacctgcgcaccatcactccgaccggtcacaccccgctgctgggccgacccttcgtg
cacggtgcctgggactgctggcaggtctgcgcggactggtataagcgcgagtgggggttg
gattttccggcatacgcccgggaggagggatggtgggagcaggcagacggcccgagcctt
tacgagcagacctacgaggctgctggcttttaccaggtcagccagcctcagcgcggcgac
atgatcgtgatgtctgtcggccggacagctcacccgaaccacgccggcatctacctgggc
gctgacgctcggctgcccgtggaagcggcggaggtcttcggccctggcccgttcatgctg
caccacttgctggggcggccatcagaaattgttgtgtttggcgggccctggctcgatcgg
acgcggcttgtgcttcgccatcgcgatgccaagtga

DBGET integrated database retrieval system