KEGG   Pseudomonas putida W619: PputW619_0100Help
Entry
PputW619_0100     CDS       T00675                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00260  Glycine, serine and threonine metabolism
ppw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01130  Biosynthesis of antibiotics
ppw01230  Biosynthesis of amino acids
Module
ppw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PputW619_0100
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PputW619_0100
Enzymes [BR:ppw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PputW619_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase ThiG KDGP_aldolase BtpA PA Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACA70606
UniProt: B1J4B0
Position
complement(107591..108400)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQNLAKTLQMVREFRVDNQATPIVLMGYYNPIHRFGVEKFVAEAKE
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAAIARLADGVVVGSALVDKI
AQAKDADQAVADVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgctttgccgagctgaaagccgaaggccgctccgcactggta
accttcgtcaccgccggcgaccctggctacgatgcctcactgcagatcctcaagggcctg
ccggcggccggtgccgatgtgatcgaactgggcatgccgttcaccgacccgatggccgat
ggcgtagccatccagctggccacgctgcgtgcgctggaagcaggccagaacctggccaag
accctgcagatggtgcgtgaattccgcgtcgacaaccaggccacaccgatcgtgctgatg
ggttactacaacccgatccaccgctttggtgtagagaaattcgtcgcagaagccaaagaa
gcgggtgtcgatggcctgatcatcgtcgacctgccgccggagcacgatgctgagctcgcc
accccggcccaggccgctggcatcgacttcattcgcctgaccaccccaaccaccgacgat
gcgcgcctgccacgggtgctggagcgcagctccgggttcgtctattacgtgtcggtggca
ggcgtgaccggcgccggctcggcaaccaccgagcacgtgaccgaagccatcgcccgcctg
cgtcggcataccgatctgccgatcagcgttggcttcggcattcgtacaccagagcaggcc
gcagcgattgcgcgcctggctgatggcgtggtggtggggtcggcgctggtcgacaagatc
gcccaggccaaggacgccgatcaggccgttgccgatgtattgagcctgtgctctgcgctg
gctgaaggtgtgcgcggcgctcgacgctga

DBGET integrated database retrieval system