KEGG   Pseudomonas putida W619: PputW619_0183Help
Entry
PputW619_0183     CDS       T00675                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00010  Glycolysis / Gluconeogenesis
ppw00030  Pentose phosphate pathway
ppw00051  Fructose and mannose metabolism
ppw00052  Galactose metabolism
ppw00230  Purine metabolism
ppw00500  Starch and sucrose metabolism
ppw00520  Amino sugar and nucleotide sugar metabolism
ppw00521  Streptomycin biosynthesis
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputW619_0183
   00030 Pentose phosphate pathway
    PputW619_0183
   00051 Fructose and mannose metabolism
    PputW619_0183
   00052 Galactose metabolism
    PputW619_0183
   00500 Starch and sucrose metabolism
    PputW619_0183
   00520 Amino sugar and nucleotide sugar metabolism
    PputW619_0183
  Nucleotide metabolism
   00230 Purine metabolism
    PputW619_0183
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PputW619_0183
Enzymes [BR:ppw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PputW619_0183
    5.4.2.8  phosphomannomutase
     PputW619_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ACA70689
UniProt: B1J4L8
Position
complement(187772..189169)
Genome map
AA seq 465 aa AA seqDB search
MNDMAHLVPALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQTLAQGEPQISVGRDGR
LSGPMLVEQLIKGLADAGCQVSDVGLVPTPALYFAANVLAGKSGVMLTGSHNPSDYNGFK
IVIAGDTLANEQIQALLTRLKTNDLTRGEGSVEKVGILERYFQQIVADVKLAKKLKVVVD
CGNGAAGVIAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADIG
LAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLARNPGAEIIFDVKCTRRLTPLIEQHG
GRALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKADQ
DAESLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGQACLTTIDGVRVDYAQGWG
LVRASNTTPVLVLRFEAESDAELQRIKDVFRAQLLRVAPELQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatggcccacctggtccccgcactgcccgacagcattttccgcgcctatgac
atccgcggggtggtcggcaagaccctgcacgccgaaaccgcttactggatcggccgcgcc
attggcgcgcagacgctcgcccaaggcgagccgcagatttctgttggccgcgacggccgc
ctgtccggcccgatgctggtcgagcagctgatcaaaggcctggccgatgccggttgccag
gtcagcgatgttggcctggtgccgaccccagcactgtattttgccgccaacgtcctggcc
ggcaagtccggcgtgatgctcaccggcagccacaacccttcagattacaacggcttcaag
atcgtcatcgctggcgataccttggccaacgaacagatccaagccctgctgactcgcctg
aaaaccaacgacctgacccgtggcgaaggcagtgtggagaaagtcgggatcctcgagcgc
tacttccagcagatcgtcgctgacgtgaagctggcgaaaaagctcaaggtggtggtggac
tgcggcaacggcgctgccggcgttatcgcgccgcagctgatcgaagccttgggctgcgaa
gtcatcccgctgttctgcgaggtggatggcaacttccccaaccaccacccggacccgggc
aagcctgaaaacctggaagacctgatcgccaaggtcaaggaaaccggtgccgatatcggc
ctggccttcgacggcgacggtgaccgcgttggggtagttaccaacaccggcagcatcgtt
taccccgaccgcctgctgatgctgttcgctcaggacgtgttggcgcgtaacccgggggcc
gagatcatcttcgacgtaaaatgcacccgccgcctgacaccgctgatcgagcaacacggc
ggccgcgccctgatgtggaagactggtcactctttgatcaagaagaagatgaagcagact
ggctctttgctggccggcgaaatgagcgggcacatcttcatcaaggagcgctggtacggt
ttcgacgacggtatctacagcgcggcacgcctgctggagatcctcagcaaggccgaccag
gacgccgaaagcctgtttgccgcattcccgaacgatatttccacgcctgaaatcaatatt
gatgtgaccgacgagggtaaattcagcatcattgatgcactgcaacgcgacgccgactgg
ggccaagcctgcctgaccaccatcgacggtgtgcgggtcgactatgcccagggctggggc
ctggttcgcgcctccaacaccactccggtgctggtgctgcgcttcgaggccgaaagcgac
gccgagttgcaacgtatcaaggatgttttccgcgcccagttgctgcgggttgcccctgag
ctgcaactgccgttctga

DBGET integrated database retrieval system