KEGG   Pseudomonas putida W619: PputW619_1777Help
Entry
PputW619_1777     CDS       T00675                                 

Definition
(GenBank) 2-methylisocitrate dehydratase, Fe/S-dependent
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00640  Propanoate metabolism
ppw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PputW619_1777
Enzymes [BR:ppw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     PputW619_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ACA72281
UniProt: B1J6B3
Position
1974692..1977280
Genome map
AA seq 862 aa AA seqDB search
MNTAYRKALPGTDLDYFDARAAVEAIKPGAYDSLPYTSRVLAENLVRRCDPATLSASLGQ
LIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIAEKGGDPAAVNPVVPVQLIVDH
SLAVECGGFDPQAFDKNRAIEDRRNEDRFHFINWTKKAFKNVDVIQPGNGIMHQINLEKM
SPVIHNDRGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPEIVGV
ELSGKLAPNITATDLVLALTEFLRKQKVVGAYLEFYGEGARALTLGDRATISNMAPEYGA
TAAMFAIDQQTIDYLKLTGREDQQVKLVETYAKATGLWADALVKAEYERVLSFDLSSVVR
NMAGPSNPHARVATSELAAKGIAGAWDEIPGQMPDGAVIIAAITSCTNTSNPRNVIAAGL
LARNANKLGLARKPWVKSSLAPGSKAVQLYLEEAGLEKELEQLGFGIVAFACTTCNGMSG
ALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDVLGVVDGQEIRLKDIWPSDEEIDAVVRAAVKPEQFRKVYIPMFAIEEDRGPKVAPLYE
WRPMSTYIRRPPYWEGALAGERTLRGMRPLAVLPDNITTDHLSPSNAILLDSAAGEYLAK
MGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRKPDGSVQQGSLARLEPEGKVTRM
WEAIETYMQRKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMG
VLPLEFLPGTDRKTLGLDGSETYDVAGERKPRATLTLVVTRRNGERVEVPVTCRLDTAEE
VSIYEAGGVLQRFAQDFLEATA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgcataccgcaaagccctgccaggcactgacctggactatttcgacgcccgt
gctgcggtcgaggccatcaagcccggtgcctacgacagcctgccttacacctcgcgcgtg
ctcgccgaaaacctggtgcgccgctgcgaccctgcaaccctgagcgcctcgctcggccag
ctgatcgaacgcaagcgtgatcttgacttcccgtggttcccggcccgcgtggtgtgccac
gacatcctcggccagaccgcgctggtcgacctcgccggcctgcgtgacgccatcgccgaa
aaaggcggcgacccggcggcggtcaaccctgtcgtgccggtgcaactgatcgtcgatcac
tcgctggccgtcgagtgcggtggcttcgacccgcaggcctttgacaagaaccgcgccatc
gaagaccgtcgcaacgaagaccgcttccatttcatcaactggaccaagaaggcgttcaag
aacgtcgatgtgatccagcccggtaacggcatcatgcaccagatcaatctggagaaaatg
tcgccggtaattcacaacgatcgcggtgttgcctacccggacacctgcgtgggcaccgac
agccatactccacatgtcgacgccctgggcgtgatcgccatcggcgtcggcggcctcgaa
gctgaaaatgtcatgctgggccgcgcctcctggatgcgcctgccggaaattgtcggcgtg
gagctcagcggcaagctggcgcccaacatcaccgccaccgacctggtgctggccttgacc
gagttcctgcgcaagcagaaggtggttggcgcctaccttgagttctacggcgaaggtgca
cgcgccctgaccctcggcgaccgtgcgaccatctccaacatggcaccggaatatggtgca
accgctgcaatgttcgccatcgaccagcaaaccatcgactacctgaaactgaccggccgt
gaagatcagcaggttaaactggtggagacctacgccaaggccacgggtttgtgggctgac
gcgttggtgaaggccgaatacgaacgcgtgctgagcttcgacctgtcgagcgtggtgcgc
aacatggccgggccgtccaacccgcatgcccgtgttgccaccagtgagctggcagccaag
ggcatcgctggtgcctgggacgagataccggggcagatgcctgacggcgcagtgatcatc
gctgcgattaccagttgcaccaacaccagcaacccgcgcaacgtgatcgcagctggcctg
ctggcacgcaatgccaacaagctcggcctggcacgcaagccgtgggtcaagtcttcgctc
gcgcccggctccaaggcagtgcagctgtacctggaggaagcggggctggagaaggagctg
gagcaactgggcttcggtatcgtcgctttcgcctgcaccacctgcaacggcatgtccggt
gctttggacccggtgattcagcaggaaatcatcgaccgtgacctctacgcgacggcggtg
ctctcgggcaaccgcaacttcgatgggcgcatccacccgtacgccaagcaggcattcctc
gcttcgccgccgctggtggtggcctatgccattgccggcactatccgcttcgacatcgag
aaggatgtactgggcgtagtcgatggtcaggagatccgcctcaaggacatctggccaagc
gacgaagagatcgacgcggtggtgcgcgcggcggtcaaaccggagcagttccgcaaggtc
tacatcccgatgttcgctatcgaggaagaccgtgggccgaaagtggcgccgctttacgag
tggcgtccgatgagtacctatatccgccgcccgccctactgggaaggcgccctggccggt
gagcgcacgttgcgcggcatgcgtccgttggcggtgctgccggacaacatcaccaccgac
cacctgtcaccttccaatgccattctgctcgacagcgcggcgggtgaatacctggccaag
atgggcttgccggaggaggacttcaactcctacgccacgcaccgcggcgaccacctgacg
gcacagcgtgccacattcgccaaccccaagctgttcaacgagatggtgcgcaaacccgat
ggcagcgtgcagcagggttcgctggcgcgcctggagccggagggcaaggtgacccggatg
tgggaagccatcgaaacctacatgcagcgcaagcagccgctgatcatcgttgccggtgcc
gactatgggcaaggctcgtcccgcgactgggcggccaagggcgtgcggctggcgggcgtc
gaggcgatcgtggccgaaggcttcgagcgcattcaccgcaccaacctggtgggcatgggc
gtcctgccgctggaattcctgccggggaccgaccgcaagaccctgggcctggatggcagc
gagacctatgacgtggcaggtgagcgcaagccgcgtgcaaccctgacgctggtggttacg
cgccgcaatggcgaacgggtcgaggtgccggtgacctgccggctcgataccgccgaagag
gtgtcgatctacgaggcgggcggggtactgcagcgcttcgcccaggatttcctcgaagcc
accgcctga

DBGET integrated database retrieval system