KEGG   Pseudomonas putida W619: PputW619_1984Help
Entry
PputW619_1984     CDS       T00675                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00360  Phenylalanine metabolism
ppw00362  Benzoate degradation
ppw00621  Dioxin degradation
ppw00622  Xylene degradation
ppw01100  Metabolic pathways
ppw01120  Microbial metabolism in diverse environments
ppw01220  Degradation of aromatic compounds
Module
ppw_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PputW619_1984
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputW619_1984
   00622 Xylene degradation
    PputW619_1984
   00621 Dioxin degradation
    PputW619_1984
Enzymes [BR:ppw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     PputW619_1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: ACA72485
UniProt: B1J6Y7
Position
2210179..2211192
Genome map
AA seq 337 aa AA seqDB search
MNGKKLYISDVTLRDGMHAIRHQYSLDDVRAIATALDRAKVDSIEVAHGDGLQGSSFNYG
FGAHTDLEWIEAAADAVSHAKIATLLLPGIGTIHDLKNAYDAGARIVRVATHCTEADVSR
QHIEYARELGMDTVGFLMMSHMQTPEGLAQQAKLMESYGATCIYVVDSGGAMNMEDIRAR
FRTVKAVLKADTETGIHAHHNLSLGVANSIAAVEEGCDRIDASLAGMGAGAGNAPLEVFI
AAADKLGWNHGTDLYALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEMAAA
RYGIKAVDILVELGKRRMVGGQEDMIVDVALDLLARR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaagaaactctacatctccgacgtgaccctgcgcgatggcatgcacgccatc
cgccaccagtattcgctggatgacgtgcgggccatcgccaccgccctggatcgggccaag
gtcgactccatcgaagtcgcccacggcgatggcctgcagggttcgagcttcaactacggc
tttggtgcccacaccgacctcgaatggatcgaagcagccgccgacgcggtcagccacgcc
aagatcgccacgctgctgctgccagggatcggcactatccatgatctgaagaacgcctac
gacgccggtgcccgcatcgtgcgcgtggccacccattgcaccgaagcggacgtttcgcgc
cagcacatcgagtatgcccgcgagctgggcatggacaccgtgggcttcctgatgatgagc
cacatgcagacgcctgaagggctggcgcagcaggccaagctgatggagagctacggcgcc
acctgcatctacgtggtggactcgggtggcgcgatgaacatggaagatatccgagcgcga
ttccgcaccgtgaaggcggtgctgaaggcggacaccgagaccggtatccatgcgcaccac
aacctcagcctgggggtggccaactccatcgccgcggtggaggagggctgcgaccgcatc
gacgccagcctcgccggtatgggcgccggtgccggcaacgctccgttggaagtgttcatc
gccgccgccgacaagctcggctggaaccacggcaccgacctatacgcgctgatggatgcc
gccgacgacctggtccgtccgctgcaggaccggccggtgcgggtggaccgcgaaaccctg
gcgctgggttatgccggggtctactcgagcttcctgcgccattccgagatggccgctgcc
cgctatggcatcaaggcggtggacattcttgtcgagctgggcaaacgacgcatggtcggt
ggccaggaagacatgatcgtcgacgtagcactggacctgctcgctcgccgttga

DBGET integrated database retrieval system