KEGG   Pseudomonas putida W619: PputW619_2196Help
Entry
PputW619_2196     CDS       T00675                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00071  Fatty acid degradation
ppw00072  Synthesis and degradation of ketone bodies
ppw00280  Valine, leucine and isoleucine degradation
ppw00310  Lysine degradation
ppw00362  Benzoate degradation
ppw00380  Tryptophan metabolism
ppw00620  Pyruvate metabolism
ppw00630  Glyoxylate and dicarboxylate metabolism
ppw00640  Propanoate metabolism
ppw00650  Butanoate metabolism
ppw00900  Terpenoid backbone biosynthesis
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01130  Biosynthesis of antibiotics
ppw01200  Carbon metabolism
ppw01212  Fatty acid metabolism
ppw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputW619_2196
   00630 Glyoxylate and dicarboxylate metabolism
    PputW619_2196
   00640 Propanoate metabolism
    PputW619_2196
   00650 Butanoate metabolism
    PputW619_2196
  Lipid metabolism
   00071 Fatty acid degradation
    PputW619_2196
   00072 Synthesis and degradation of ketone bodies
    PputW619_2196
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputW619_2196
   00310 Lysine degradation
    PputW619_2196
   00380 Tryptophan metabolism
    PputW619_2196
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PputW619_2196
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputW619_2196
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputW619_2196
Enzymes [BR:ppw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PputW619_2196
Exosome [BR:ppw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PputW619_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACA72696
UniProt: B1J7J6
Position
complement(2442695..2443879)
Genome map
AA seq 394 aa AA seqDB search
MSSAEIYVVSAVRSAIGGFGGSLKDLPLADLATAISRAALERSGVAPEQVGHVVMGNVIP
TEPRDAYLSRVAAMNAGIPKETPAFNVNRLCGSGLQAIVSATQCLLLGDADVALAAGAES
MSRGPYLLPQARWGARMGDLQGIDYTVGVLQDPFEHFHMGITAENVAAKHGITRQMQDEL
ALTSQRRAARAIAEGRFASQIVPLELKTRKGTVEFAVDEHVRGDVTAEQLAGMKTVFKKD
GTVTAGNASGINDGAAGLVLATGDAVHRLGLKPLARLVAYAHAGVEPELMGLGPIPATRK
ALEKAGLNISDLDVIESNEAFAAQACAVARALDFDPEKVNPNGSGISLGHPVGATGAIIA
TKAIHELQRIQGRYALATMCIGGGQGIAVVFERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcagaaatctacgtcgtcagtgccgtccgttccgccatcggtggttttggt
ggctcgctcaaggacctgccgctggcagacctcgccaccgccatcagccgcgccgccctc
gagcgctcgggcgtagcccctgagcaggtcggccatgtggtcatgggtaatgtcatcccc
accgaaccacgcgacgcctacctgtcgcgggtcgccgcgatgaacgctggtatccctaag
gaaaccccggcgttcaacgtcaaccgcctgtgcggttcgggccttcaggccatcgtttcc
gctacccagtgcctgctgctgggtgatgccgatgtggccctggccgccggtgccgagtcc
atgagccgtggcccttacttgctgccacaggcccgctggggtgcacgcatgggcgacctg
caaggcatcgactacaccgtcggcgttctgcaggacccgttcgaacacttccacatgggc
atcacggcggaaaatgtcgccgccaagcacggcatcacccgccagatgcaggatgaactg
gccctgaccagccagcgccgcgccgcccgtgccatagctgaaggccgcttcgccagccag
atcgtgccgctggaactgaaaacccgcaaaggcaccgtcgagtttgccgttgacgaacac
gtacgcggcgatgtgaccgccgaacagctggccggcatgaaaaccgtcttcaagaaagac
ggcaccgttaccgccggcaatgccagcggcatcaatgacggagctgccggcctggtgctg
gcgaccggtgacgccgtacaccgcctgggcctcaagccgctggcgcgcctggtggcctac
gcccatgccggcgtcgagcccgagctgatgggcctggggccgatcccggcaacacgcaaa
gccctggaaaaggccggcctaaacatcagcgacctagacgtgatcgagtccaatgaagcc
ttcgccgcccaagcctgtgccgtagcccgcgcgctggacttcgacccggagaaggtcaac
ccgaacgggtccggcatttccctgggccacccggtgggtgccaccggggcgatcatcgcc
accaaggccatccatgaactgcagcgtatccagggccgttacgcgctggccaccatgtgc
attggcggcggccagggcatcgccgtcgtcttcgagcgcgtctga

DBGET integrated database retrieval system