KEGG   Pseudomonas putida W619: PputW619_2407Help
Entry
PputW619_2407     CDS       T00675                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PputW619_2407
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppw01007]
    PputW619_2407
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppw03016]
    PputW619_2407
Enzymes [BR:ppw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     PputW619_2407
Amino acid related enzymes [BR:ppw01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   PputW619_2407
Transfer RNA biogenesis [BR:ppw03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PputW619_2407
 Prokaryotic Type
    PputW619_2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ACA72907
UniProt: B1J805
Position
2676166..2677548
Genome map
AA seq 460 aa AA seqDB search
MLTIYNTLSKTKEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRKSGYE
LTYVRNITDIDDKIINRANENGETFDALTARMIDAMHEDERRLNILKPDQEPRATDHIAG
MHAMIQTLIDKGYAYAPGNGDVYYRVGKFVGYGKLSRKKIEDLRIGARIEVDEAKQDPLD
FVLWKGVKPGEPYWDSPWGPGRPGWHIECSVMSTCCLGESFDIHGGGSDLEFPHHENEIA
QSEAATGKQYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLDVYHPEVVRYLLVASHYRS
AINYSEDSLRDAKGALERFYHALRGLPRVAAKGGEEFVERFSVAMNDDFGTPEACAVLFD
LVREINRLRDSDPDAAAGLAGRLRELGDVLGVLQLEADDFLRAGAEGKVDAAEVEALIQA
RLQARADKNWAESDRIRDQLTAMGVVLEDSKGATTWRLAD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaccatctacaacacgctgagcaaaaccaaggaagtcttcaagccgctcgatggc
aacaaggtgcgcatgtacgtgtgcggcatgaccgtgtacgactactgccaccttggccat
ggccgcagcatggtggccttcgacctggtcacgcgctggctgcgcaagagcggctatgag
ctgacctatgtgcgcaacatcaccgacatcgacgacaagatcatcaaccgggccaacgag
aacggcgaaacgttcgacgcgctgacggcccgcatgatcgatgcgatgcacgaagatgaa
cggcgcctgaacatcctcaagccggatcaggaaccgcgagccaccgatcatatcgccggc
atgcacgcgatgatccagaccctgatcgacaagggttacgcctacgcaccgggcaatggc
gacgtgtactaccgggtcgggaagttcgtcggctacggcaagctgtcgcgcaagaagatc
gaggacctgcgcatcggtgcccgcatcgaggtcgacgaggccaagcaggacccgctcgac
ttcgtgctgtggaaaggcgtcaaaccgggcgaaccgtactgggattcgccttggggaccg
ggccgtccgggctggcacatcgagtgctcggtgatgtccacctgctgcctgggcgagagc
ttcgacatccacggtggcggcagcgacctggagttcccgcaccacgagaacgaaatcgcc
cagagcgaagcggcgaccggcaagcagtacgccaacgcctggatgcattgcggcatgatc
cgcatcaatggcgagaagatgtccaagtcattgaacaacttctttaccatccgtgacgtg
ctcgacgtgtaccacccggaggtggtgcgctacctgctggtggccagccactaccgcagt
gccatcaactactccgaagacagcttgcgtgatgccaagggtgccctggagcgcttctat
cacgcactgcgtggcttgccacgtgtggcggccaagggtggtgaggaattcgtcgagcgc
ttcagcgtggcgatgaacgacgacttcggcacccccgaagcctgcgctgtgctgttcgac
ctggtgcgcgaaatcaaccgcctgcgcgacagcgacccggatgcggctgccggcctggcc
ggtcgcctgcgtgagctgggtgatgtgctgggtgtactgcagctggaggccgatgacttc
ctgcgtgcaggggctgagggcaaggtcgatgcggctgaagtagaagcgctgatccaggcg
cgcctgcaggcgcgtgccgacaagaactgggcagagtccgaccgtatccgcgaccagctg
accgccatgggcgtagtgctggaagacagcaagggcgcgaccacctggcgtctggctgac
tga

DBGET integrated database retrieval system