KEGG   Pseudomonas putida W619: PputW619_2499Help
Entry
PputW619_2499     CDS       T00675                                 

Definition
(GenBank) OmpA/MotB domain protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppw  Pseudomonas putida W619
Pathway
ppw02025  Biofilm formation - Pseudomonas aeruginosa
ppw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PputW619_2499
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PputW619_2499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppw02044]
    PputW619_2499
Secretion system [BR:ppw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputW619_2499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related OmpA MMR_HSR1 DUF1232
Motif
Other DBs
NCBI-ProteinID: ACA72999
UniProt: B1J8G6
Position
complement(2774090..2776585)
Genome map
AA seq 831 aa AA seqDB search
MNKIKYYCLRYQPYLLGLAFFLAIFVVWALGRALGFASLHSLLAGIGVFLLLSAGYVLLL
YRGAGQHHNLEALLRDDADQAVLNATPADREEISLLRERLLQSIERLHSNKPRATPAKDA
LYALPWYLVIGQPAAGKSTMILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDT
AGRYMNSPEEAGKWRGFLQLLRQHRQRRPLNGLIVSVSIADILHGSAEDQERVAKRLRER
IQESCALLEVRLPIYLVFTKCDLIPGFTPFYRQLDDAARGEVMGKTFSHKGYEQADWGQR
FGKAMDELTGYWEQVASQQLMQQDIQVTRQNNAAYRFPLELAALKPRLQQFVDSLLRANP
YQNAELLRGFYFTAALEADDALWGSHGQHVAERFALAHGQDRSGGNSQPAPLFINSLFRK
VIIPDQHLVAVYTSNRRERQRKAAWVGAASLAGLLLCSLWGWSYMNNRNTLDTMAAELAQ
AKREDQANPGHYAPWHSLDRLRFWAAHYYQQHHDQAVPLGMRLGLYQGHAVEPVLRARYF
ATLQNVMLKPTADNLTRTLYLLTTLKVYQRNTRELQPVTGVDSVEAEALPHDNRAQSIAD
FGKAALDTYVMLSPAQREKADPALLKARLPDYWYPAIARHTGKRMDAAGGESPANQDYLY
ASRQIVFYSDQIREPDVPRILDNAFLMSSSRNYINSLLTQSLRSIETITLESDTLFAFAR
ADFQSLKSEGQNQLSAIASKLLNTPNIGKIIISGHADQLGDAQGNLQVSRQRAQTIRTYL
VGKGVPAELVSAQGEGSRKPLVNCDMQQPRAQLIKCLEPNRRVEIEVRGLN
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcaagtactactgcctgcgctatcaaccttacctcctggggctggccttc
ttcctggcgatcttcgtggtgtgggccctgggccgtgccctgggttttgcctcgctgcac
agcctgctcgcgggcattggcgtgttcctgctgctgtcggcgggctatgtactgctgctt
taccgtggcgcaggccagcaccacaaccttgaggcgctgctgcgtgatgacgcagaccag
gcggtactcaacgccaccccggccgaccgcgaagaaatcagcctgctgcgcgagcgcctg
ctgcagagcatcgagcgcctgcacagcaacaaaccacgcgccacccctgcaaaggacgcc
ttgtacgccctgccctggtacctggtgatcggccaaccggccgccggcaaaagcaccatg
atcctgcagtccgggctcaatttcccttacgccgagcgcgaaggtgcgcgggttgcaggc
ttgggcggcacgcgcaactgcgactggttcttcagctccgaagcggtgctgctggacacc
gccggccgctacatgaacagccccgaggaagccggcaagtggcgtggttttctgcagctg
ctacgccagcaccgccagcgccggccactcaacgggctgatcgtcagcgtcagcatcgcc
gatatcctgcatggctcggccgaagaccaggagcgtgtggccaagcgcctgcgcgagcgt
atccaggaaagctgcgccctgctggaagtacgcctgcccatctacctggtgttcaccaaa
tgcgacctgatcccaggcttcacacccttctaccgccagctggatgacgcagcgcgcggt
gaggtgatgggcaagacgttctcgcacaaaggctatgaacaagccgactggggccagcgc
ttcggcaaggccatggacgagctgaccggctattgggagcaggtggcgagccagcaactg
atgcagcaggatattcaggtaacccgccagaacaatgccgcctaccgcttcccgctcgag
ctggctgcgctcaagccacgcttgcagcagttcgtcgacagcctgctgcgggccaacccg
taccagaacgccgaactgctgcgtggtttctatttcaccgcagcgctggaagccgacgac
gccctgtggggcagccatggccagcatgtcgccgagcgtttcgccctggcgcatggccag
gaccgtagcgggggtaacagccagccggcaccgcttttcatcaacagcctgttccgcaag
gtgataatccccgaccagcacctggtggcggtgtacaccagcaaccgccgtgaacgccag
cgcaaggccgcctgggtgggtgccgccagcctggcgggattgctgctgtgcagcctgtgg
ggctggtcgtacatgaacaaccgcaacaccctcgacaccatggccgccgaacttgcccag
gccaagcgcgaagaccaggccaaccctggccattacgccccttggcacagcctcgaccgc
ctgcgtttctgggcagcacactactaccaacagcaccacgaccaggccgtgccgctgggt
atgcgcctgggcttgtaccagggccatgcggtcgagccggtactgcgtgcgcgctacttc
gccaccctgcagaacgtgatgctcaagcccacggcagacaacctgacacgcaccctgtac
ctgctgaccacactgaaggtctaccagcgcaatacccgtgagttgcagccggtgaccggt
gtcgacagtgtcgaggcagaagccctgccccatgacaaccgtgcccagtcgatcgccgac
ttcggcaaggcagcgctggacacctacgtgatgctgtcacctgcccagcgggaaaaggcc
gacccggcattgctcaaggccaggttaccggactactggtacccggccatcgcccgccac
accggcaagcgcatggacgccgccggcggcgaaagtcctgccaaccaggactacctgtac
gccagccgccagatcgtgttctacagcgaccagatccgtgaacccgatgtaccgcgcatc
ctcgacaacgcgttcctgatgtccagttcgcgcaactacatcaacagcctgctgacccag
tcgttgcgctcgatcgaaaccatcacgctggagtccgacaccctgttcgcctttgcccgc
gccgacttccagagcctcaagagcgaaggccagaaccagctgagcgctatcgccagcaaa
ctgctgaacaccccgaacatcggcaagatcatcatctcgggccacgccgaccagctcggc
gatgcccaaggcaacctgcaggtttcccggcaacgggcgcaaaccatccgcacctacctg
gtcggcaagggcgtacccgccgagctggtaagtgcacagggcgaaggcagccgcaaaccg
ctggtcaactgcgacatgcaacaaccgcgggcgcaactgatcaagtgcctggagcccaac
cggcgggtggaaatcgaagtgcgcgggctcaactga

DBGET integrated database retrieval system