KEGG   Pseudomonas putida W619: PputW619_2501
Entry
PputW619_2501     CDS       T00675                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
ppw  Pseudomonas putida W619
Pathway
ppw02025  Biofilm formation - Pseudomonas aeruginosa
ppw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PputW619_2501
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PputW619_2501
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppw02044]
    PputW619_2501
Secretion system [BR:ppw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputW619_2501
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C MMR_HSR1
Other DBs
NCBI-ProteinID: ACA73001
UniProt: B1J8G8
Position
complement(2777487..2781293)
AA seq 1268 aa
MKTLLRLLKSFWILLPLLWLVTLLICWLVAPMVPWLRHHVPEALAIISACFLLVIVLRQY
QRIRAEHNLENLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSD
LPWYLVIGMSAAGKTSLLTHSGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRD
DQSASEFSAFLRMLRKQRGKAAINGLVLVVSLPELLAANSDGRNALAAQLVARVEEYAEC
LGTNPPVYLMLSKTDQLPGFNQAFEGLDLHQRQQPLGMTFGLSEIRNNGLQAVLNTRLKN
LQSHIRRHVDAQMISLGADADSTLLNFPQYFAELNGVLEQFLEHFTRGQGGGAPLLLRGL
YFTSALQTEQQLGQVYDDVIADNFALQAAHDEGAQPASHTQGNRSYFITDTFRQVIFPDR
DLTLYQSRLGRKAGFSPLLLGLAAAAGVAFIGWQALSFANNRQWLDSLRGQLAEIERADD
RAQLLAAGKGLEVLRGQMATVEAHRQQGVPLQLSAGLYHGEAIHQVARDAYLAQLRSQAL
EPIARSLQVQMRAFNTFASGINQELEFTPAPKSRNGKPLTPRLAAKAQAALTKTRAGAYA
AKVNLATASDAAELSATTGGLSLSEEMLGRLDEQQVASIIEAYNTLKLYLLLTEPQAHPD
PAFVAASLPQAWAGAATQGSPADAAVISENAPLYVQLLEQGQAPSLPRNQQLIDETRQNL
KAFMISSSLVDREYLRLQLESSRQFPALSLNDLVPTPGRNLLYSSAGVPAIYTRQGWDTF
VKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMARYKRDYTQAWYKMVSSVGV
RHFADLASATEHLGLLSDVQNSPVKNLLAAVNDNTQWDLPVKRDTTPTGNARADGFWSKV
TGLIDEAKDVAPEALAPSLPAVDDGSLAKRFEPVARVFAANNAEGADSTIMDRYLAALRK
LKVRMNNIQRSQDVGKSSKQLISETLEGQPSEVTTVRNYVETSVDTSQDGLSRSLQGLFS
LPIQYAWETLRDPAGQQIAKAWKQQIAKPWEQVMAHRYPIATGSRNEASVKDLQRFVDPE
SGLLPTFKRNEIGNLSGGEGLGLSNGKAPALVNPGMLNSIDKASNVGQVIASLSDRDNGF
EIMLEPSANFTDIVFTLDGQEQHYRNGRSSWSRFAWPGTNNTPGARLDVVTLSGARITVF
DFPGRWGLLRMNESARVDDLDGIQQRFSWNTANGRVSLVVRNFGGVKLTDLGDVKALSAL
NDAGRGAQ
NT seq 3807 nt   +upstreamnt  +downstreamnt
atgaaaacattactgcgtctgttgaagagtttctggattctcctgccactgctgtggttg
gtgaccctgttgatctgctggctggtggcaccgatggtgccctggctgcgccaccatgtg
cccgaagcgctggccatcatcagcgcctgcttcctgctggtgatcgtgctgcgccagtac
cagcgcatccgcgccgagcataacctggagaacctgctgcagatcgaggtcgatcgctcg
tggaacgccaccggtgaattccgcgaccagcaagtgctgcgcgagcgcctcaagcatgcc
atcgccatgctgcgcaccgaccgctccgccggtggcggtggcaaggcggccctgtccgac
ctgccctggtacctggtgatcggcatgtcggctgcaggcaaaacctcgctgttgacccac
tcgggcctctcggccagcatcgccaccgccaatgacagcgaaagtggcacccagcactgt
gactggtatttcagccccgacgcagtgatgatcgacaccgcaggccgttacctgcgcgac
gatcagtctgccagcgagttttcagccttcctgcgcatgctgcgcaagcaacgcggcaag
gcagcgatcaacggcctggtgctggtggtcagcctgcctgaactgttggcggccaacagc
gacggccgtaacgcgcttgccgcgcagttggtggcgcgcgtggaggaatacgccgagtgc
ctgggcaccaacccgcctgtgtacctgatgctgagcaagaccgaccagttgcccggcttc
aaccaggccttcgaaggcctggacctgcaccagcgccagcagccgctgggcatgaccttt
ggcctgtcggaaatccgcaacaacggtttgcaggcggtgctcaacactcgcctgaaaaac
ctgcaaagccacatccgccgccacgtcgatgcgcagatgatcagcctcggcgcagatgcc
gacagcacactgctcaacttcccccagtacttcgcagaactcaatggcgtgctggagcag
ttccttgagcacttcacccgcggccagggtggcggtgccccgctgctgttgcgcggcttg
tacttcaccagtgcgctgcagaccgagcagcaactgggccaggtgtacgatgacgtcatc
gccgacaactttgccctgcaagcggcccacgatgaaggcgcccagccggccagccacacg
cagggcaaccgcagctacttcatcaccgacacattccgccaggtgattttccccgaccgc
gacctgaccctgtaccagtcgcgcctgggccgcaaggcaggcttcagccccctgttgctg
ggcctggccgctgccgccggggtggcctttatcggctggcaggcgctatcgttcgccaac
aaccgccagtggctggacagcctgcgtggccaactggccgaaatcgaacgcgccgatgac
cgcgcacagctgttggctgccggtaaaggcctggaagtgctacgcgggcagatggccacg
gtcgaggcccatcgccagcagggtgtcccgctgcaattgagcgccggcctgtaccacggc
gaggctattcaccaggtggcccgcgacgcctacctggcgcaactgcgcagccaggcactg
gagccgattgcccgcagcctgcaggtgcagatgcgtgcgttcaacacctttgccagcggc
atcaaccaggagctggagttcaccccggcgccgaaaagccgcaatggcaaaccgttgacg
cctcgcctggcggccaaggcccaagcggccctgaccaaaacccgtgccggcgcctacgcc
gccaaggtcaacctggccacggccagcgacgcggccgaattgtccgccaccaccggcggc
ctgtcactgtcagaagagatgctcggacgcctggacgaacagcaggtggcgtcgatcatc
gaggcctataacaccctcaagctgtacctgctgttgaccgagccacaagcccacccggac
ccagccttcgtcgctgccagcctgccgcaggcctgggcaggcgccgcaacccaaggttcc
cccgccgacgcagccgtcatcagcgaaaacgcccctctgtacgttcaattgctggagcaa
ggccaggcgccgtcgctgccgcgtaaccaacagctgatcgacgaaacccggcagaacctc
aaggcattcatgatttccagctcgctggtggatcgcgaatacctgcgcctgcaactggag
tccagccgccagttcccggcgctgagcctcaacgacctggtgccaacgcctggccgtaac
ctgttgtacagctctgccggcgtgccggcgatctatacccgccagggctgggacaccttc
gtcaagcccgagctgatcaagctggtttcgggcaacctgcgcaacgagtcggactgggtg
ctcgacggcgaaggcggcgatgccatcgtgcagaaagccaacttcgtgcgcgagttcatg
gcccgctacaaacgcgattacacccaggcctggtacaagatggtcagcagcgtgggcgtg
cgccacttcgccgacctggcctcggccacagaacaccttgggctgctcagcgatgtgcag
aactcgccggtgaagaacctgctggcagcggtcaatgacaacactcagtgggacttgccg
gtcaagcgcgacaccacgcctacgggcaatgcccgcgcggacggcttctggagcaaggta
accggcctgatcgacgaagccaaagacgtggcgcctgaagccctggcccctagcctgccg
gccgtggacgacggcagcctggccaagcgtttcgagccggtcgcccgggtgttcgcagcc
aacaacgccgaaggcgccgacagcaccatcatggaccgctacctggccgcgctgcgcaag
ctcaaggtgcgcatgaacaacatccagcgctcgcaggatgtcggtaaaagcagcaagcag
ctgatcagcgaaactctggaaggccagccgagcgaggtgaccaccgtgcgcaactacgtg
gaaaccagcgtcgacaccagccaggacggcctgtcgcgttcgctgcagggcctgttcagc
ctgccgatccagtacgcctgggaaaccctgcgcgacccggccggccaacagatcgccaaa
gcctggaagcagcagatcgccaagccctgggagcaggtcatggcgcaccgttacccgatc
gccaccggcagccgcaacgaagcttcggtcaaggacctgcagcgtttcgtcgaccccgaa
agcggcctgctgccgaccttcaagcgcaacgagatcggcaacctgtccggcggtgaaggg
ctgggcctgagcaacggcaaggcgccggcgctggtcaacccggggatgctcaacagcatc
gacaaggccagcaacgtgggtcaggtgatcgccagcctgtcggaccgcgacaacggcttc
gagatcatgcttgagccgtcggccaactttaccgacattgtgttcacccttgatggccag
gagcagcactaccgcaacggccgcagcagctggagccgctttgcctggccaggcaccaac
aacacgccgggcgcacgcctggacgtggtcaccctcagcggtgcacgcatcaccgtgttc
gacttcccggggcggtggggcctgctgcgcatgaacgaaagcgcccgggtcgacgacctg
gacggcatccagcagcgcttcagctggaacacggccaatggccgggtcagcctggtggtg
cgcaacttcggcggggtcaaactcaccgacctgggcgacgtcaaggcgctgagcgccctc
aacgacgctggcaggggcgcacaatga

DBGET integrated database retrieval system