KEGG   Pseudomonas putida W619: PputW619_2504
Entry
PputW619_2504     CDS       T00675                                 

Definition
(GenBank) lipoprotein, putative
  KO
K11906  type VI secretion system protein VasD
Organism
ppw  Pseudomonas putida W619
Pathway
ppw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PputW619_2504
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppw02044]
    PputW619_2504
Secretion system [BR:ppw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputW619_2504
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ACA73004
UniProt: B1J8F3
Position
complement(2783377..2784099)
AA seq 240 aa
MYHTHTALKRLTVAALLLALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNP
DAEGKPLSVVMRVYQLTDLERFAATDAETLWDTPEKALGNTLVEARELTLLPGIGQTDQW
PLAKTARYVGVAAFFRNEQDARWKVAFDAESLRKDGIWFSSDGLRVLVDNTEISALRGVD
VLNKPPTADQLAAAQKADDTPPALTDKVQDAVIEKATDAAGKSASNAMDSTFNSLVDSVK
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtaccacacacacaccgccctgaagcgcctgaccgtcgcagccctgctgctggcactg
gccggttgcggcgtcaccgaccgtatcggcaagcgcatggaagacagctgggcggccgat
atgctggccgacagcgagaaggtcatcctgacctccgacggtggtaaccagctcaacccc
gacgccgagggcaagccgttgtcggtggtgatgcgcgtgtaccagctgaccgacctcgag
cgctttgcagccaccgacgccgagacactttgggacacaccggaaaaagccctaggcaac
acgctggtcgaagcccgcgagctcaccctgctgccgggtatcggccagaccgaccagtgg
ccgctggccaagaccgcccgctatgtcggcgtggcagcgttcttccgcaatgagcaggat
gcccgctggaaggtcgcattcgatgccgagtcgctgcgcaaggacggtatctggttctcg
tccgatggcctgcgggtactggtggacaacaccgaaatcagcgccctgcgtggcgtcgat
gtgctgaacaagccgcccaccgccgaccagttggctgctgcgcaaaaggccgacgatacg
ccgcctgccctcaccgacaaagtgcaggacgccgtgatcgaaaaggccaccgacgctgcc
ggtaaatcggccagcaacgccatggattcaaccttcaactctttagtggatagcgtcaaa
tga

DBGET integrated database retrieval system