KEGG   Pseudomonas putida W619: PputW619_2508Help
Entry
PputW619_2508     CDS       T00675                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
ppw  Pseudomonas putida W619
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppw02044]
    PputW619_2508
Secretion system [BR:ppw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputW619_2508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ACA73008
UniProt: B1J8F7
Position
complement(2789573..2790055)
Genome map
AA seq 160 aa AA seqDB search
MSNQARLLPSLLDRLLDDRPFQSAEPAVQRTCSLAEYKASIVRDLEVLVNTRQSLVAEQI
EGFSQLGGSILEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNG
HRMLTFRVDAVLRLQDISRQVSFDAVLQVNTQEYKVQNLN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaggcccgcctgctgccctcgctgctcgaccggctgctggacgaccgtccg
tttcagtcggccgagccggctgtgcagcgcacctgctcgctggccgaatacaaggccagc
atcgtgcgcgacctggaggtgctggtgaatacccgccagtccctggtcgccgagcagatc
gaaggtttcagccagctcggtggctccatccttgaatacggcatgcccgacttcatcagc
cgcagcgtgctcgacccgcacgaccggcggctgatccagcaacagctggagcgcgcgatc
agtaccggcgaccggcgttttcgccgggtgcgcgtacagctgctggcccagcagaacggc
catcgcatgttgaccttccgcgtggacgccgtgttgcgtctgcaggacatcagccgccag
gtgtcgtttgacgccgtgctgcaggtcaacacccaggaatacaaagtgcagaacctcaac
tga

DBGET integrated database retrieval system