KEGG   Pseudomonas putida W619: PputW619_3189Help
Entry
PputW619_3189     CDS       T00675                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00040  Pentose and glucuronate interconversions
ppw00052  Galactose metabolism
ppw00500  Starch and sucrose metabolism
ppw00520  Amino sugar and nucleotide sugar metabolism
ppw01100  Metabolic pathways
ppw01130  Biosynthesis of antibiotics
Module
ppw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PputW619_3189
   00052 Galactose metabolism
    PputW619_3189
   00500 Starch and sucrose metabolism
    PputW619_3189
   00520 Amino sugar and nucleotide sugar metabolism
    PputW619_3189
Enzymes [BR:ppw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PputW619_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACA73679
UniProt: B1JA54
Position
complement(3528257..3529096)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLNECSFSYTRQTEMKGLGHAILTGQPLIG
DEPFAVVLADDLCVNPEGDGVLTQMVKLYNQFRCSIIAIQEVDPQETNKYGVIAGDMIRD
DIFRVTNMVEKPAPEDAPSNLAIIGRYILTPDIFDIIRNTPPGKGGEIQITDALMQQAQN
GCVIAYKFKGQRFDCGGAEGYIDATNFCFENYYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccggcagccggttacggcactcgcttcctgcctgctacc
aaagccatgcccaaggaaatgctgccggtggtcaacaagccactgatccagtatggcgtt
gaagaggccctggacgctggcctgaacgagatttccattgtcaccggccgcggcaagcgc
gccctggaagaccacttcgacatcagctacgagctggaaaaccagatcaaaggcaccgac
aaggaaaaatacctggtcggcatccgccgcctgctcaacgagtgctcgttctcctacacc
cgccagaccgaaatgaaaggcctgggccacgccattctgaccggccagccgctgatcggt
gacgaaccgtttgccgtggtgctggcggacgacctgtgcgtcaacccggaaggtgatggc
gtactgacccagatggtcaagctgtacaaccagttccgctgctcgatcatcgccatccag
gaagtcgatccgcaggaaaccaacaagtacggcgtgattgccggcgacatgatccgcgat
gacatcttccgtgtgaccaacatggtcgaaaagcctgcgccggaagacgccccatctaac
ctggcgatcatcggccgctacatcctgaccccggatatcttcgatatcatccgcaacacc
ccaccgggcaagggcggcgagatccagatcaccgacgcactgatgcagcaggcacagaac
ggctgcgtgatcgcctacaagttcaagggccagcgtttcgactgcggtggcgccgaaggc
tatatcgacgcgaccaatttctgcttcgagaactactacaagactggcaaggcttactga

DBGET integrated database retrieval system