KEGG   Pseudomonas putida W619: PputW619_3242
Entry
PputW619_3242     CDS       T00675                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
ppw  Pseudomonas putida W619
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppw02044]
    PputW619_3242
Secretion system [BR:ppw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputW619_3242
SSDB
Motif
Pfam: GPW_gp25 PapC_C
Other DBs
NCBI-ProteinID: ACA73730
UniProt: B1JAL8
Position
complement(3574758..3575204)
AA seq 148 aa
MPETSPSLYEILLQNFRSELALDQVNEDDQLTLSVLDNIQRILNSRAGSLSHLPDYGLPD
MGTVLQGLPASAHGLMNDIARTLRRYEPRLAQVSVQLIPQSRPGHLDYALDVVIKGGGRA
SFGTTVGAEGRVVVRHLKQEGYLPVQWN
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcctgaaaccagtccttctctttacgaaatcctgttgcagaacttccgcagtgagcta
gcgctggaccaggtgaatgaagatgaccagctgacactctcggtgctggacaacattcag
cgcattctcaacagccgtgcaggttcactctcgcatctgcccgactatggcttgccggac
atgggcacagtgctgcaagggctaccggcttcagcacatggcttgatgaacgacatcgcc
cgcaccttgcgccgctatgagccccggctggcgcaggtgagcgttcagctgatacctcag
tctcgccctggccatcttgactatgcccttgacgtggtcatcaagggcggcggcagggcg
tcctttgggaccacagtcggcgccgaaggcagggttgtggtgcgtcacctcaagcaggaa
ggctaccttcccgtgcaatggaactga

DBGET integrated database retrieval system