KEGG   Pseudomonas putida W619: PputW619_3303
Entry
PputW619_3303     CDS       T00675                                 

Definition
(GenBank) Lytic transglycosylase catalytic
Organism
ppw  Pseudomonas putida W619
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: ACA73788
UniProt: B1JAZ2
Position
3642386..3642940
AA seq 184 aa
MAAYRLILALALTGTTAVHAGSLPPPAYQLAAERAGIPASVLFAIALQESGTPLRGHLMP
WPWTLNVAGTPLRFARRDEACAALKQALIRHDPKRIDVGLGQTNLGYHLDRYHSACEALD
PRANLAVTAELLRAHYADSGDWVVAAGRYHRPAGGKPAAQYRRQFSQHWQRVQAVVGSPR
GPRP
NT seq 555 nt   +upstreamnt  +downstreamnt
atggcagcgtatcgactgatcctggcgctggccttgaccggcactacggccgttcatgcg
ggctcgctgccgccgccggcgtatcaactggccgccgagcgcgctggcatcccagcgtca
gtgctgttcgccatcgccctgcaggagagcggtacgccgctgcggggtcacctcatgccc
tggccttggaccttgaatgtcgccggcacaccgctgcgcttcgcccgccgtgatgaggcg
tgtgctgcactcaagcaggcgctgatccgccacgaccccaagcgcatcgatgtcgggctg
gggcagaccaacctcggctaccacctggaccgctatcacagtgcctgcgaggccctcgat
ccacgcgccaacctggctgtgactgccgagctgctgcgcgcccactatgccgacagcggt
gactgggtcgtggcggcaggccgctatcaccgtcctgccggcggtaaacccgcagcgcag
taccgccgacagttcagccagcactggcagcgggttcaggcagttgtgggatctccgaga
gggccacggccatga

DBGET integrated database retrieval system