KEGG   Pseudomonas putida W619: PputW619_3303Help
Entry
PputW619_3303     CDS       T00675                                 

Definition
(GenBank) Lytic transglycosylase catalytic
Organism
ppw  Pseudomonas putida W619
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT Glucosaminidase
Motif
Other DBs
NCBI-ProteinID: ACA73788
UniProt: B1JAZ2
Position
3642386..3642940
Genome map
AA seq 184 aa AA seqDB search
MAAYRLILALALTGTTAVHAGSLPPPAYQLAAERAGIPASVLFAIALQESGTPLRGHLMP
WPWTLNVAGTPLRFARRDEACAALKQALIRHDPKRIDVGLGQTNLGYHLDRYHSACEALD
PRANLAVTAELLRAHYADSGDWVVAAGRYHRPAGGKPAAQYRRQFSQHWQRVQAVVGSPR
GPRP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtatcgactgatcctggcgctggccttgaccggcactacggccgttcatgcg
ggctcgctgccgccgccggcgtatcaactggccgccgagcgcgctggcatcccagcgtca
gtgctgttcgccatcgccctgcaggagagcggtacgccgctgcggggtcacctcatgccc
tggccttggaccttgaatgtcgccggcacaccgctgcgcttcgcccgccgtgatgaggcg
tgtgctgcactcaagcaggcgctgatccgccacgaccccaagcgcatcgatgtcgggctg
gggcagaccaacctcggctaccacctggaccgctatcacagtgcctgcgaggccctcgat
ccacgcgccaacctggctgtgactgccgagctgctgcgcgcccactatgccgacagcggt
gactgggtcgtggcggcaggccgctatcaccgtcctgccggcggtaaacccgcagcgcag
taccgccgacagttcagccagcactggcagcgggttcaggcagttgtgggatctccgaga
gggccacggccatga

DBGET integrated database retrieval system