KEGG   Pseudomonas putida W619: PputW619_3305
Entry
PputW619_3305     CDS       T00675                                 
Name
(GenBank) conserved hypothetical protein
Organism
ppw  Pseudomonas putida W619
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 AAA_22
Other DBs
NCBI-ProteinID: ACA73790
UniProt: B1JAZ4
Position
3643366..3645489
AA seq 707 aa
MTEHAMESLLRPAVELYTVGICAGAGALCLHSPWAVALSPEVGAGMALAYTAFGLKRLNE
ARIVLRYRRNIRRLPRYSLTSRQIPISGKRLFMGRGFRWTRLHTQRLLEAQDPALARYVN
QSAAHQWARRMEHLLEKAPPGLSLLPRLTAWDSPLNPVRPLPPVGGSPLLHGVEPKEQEA
GLPLGERVGHTLVLGTTRVGKTRLAEVYITQDIHRPSQEVVIVFDPKGDADLLKRMYVEA
RRAGREQEFYVFHLGWPEISARYNAIGRFGRISEVATRIAGQLSGEGNSAAFREFAWRFV
NIIARALIELGRRPDYLQIQRHVVNIDALFIEYAQHFFARHDPQAWEAIVQIEGRLNEKN
IPRHMIGREKRVVAIEQYLTAKRIFDPVMDGLRSAVRYDRTYFDKIVASLLPLLEKLTSG
KTAQLLAPNYTDLDDPRPIFDWLQVIRKRGIVYVGLDALSDAEVAAAVGNSMFADLVSVA
GHIYKHGIDHGLPGSSSAADKVPINLHADEFNELMGDEFIPLINKGGGAGIQVTAYTQTL
SDIEARIGNRAKAGQVIGNFNTLQMLRVRETATAELLTNQLPKVNVQTRTLVSSATDTAD
PDARTDFTSSSQDRVTTTSVPLIEPAHIIALPKGQMFSFQEGGQLWKVRMPLPKPASDDA
MPADLQALTARMRESYNANAGSWWSTTGGAPTVDFDPEMPPPGRRHS
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgaccgaacatgcgatggagtccctgctgcgccctgcggtggaactgtacaccgtgggc
atctgcgccggtgccggcgcgctgtgcctgcattcgccctgggcggtggcgctgtcgccc
gaggtaggcgcaggcatggccctggcctataccgcatttggcctgaagcggctcaatgag
gcgcggatcgtcctgcgctaccggcgcaatatccgccgcctgccgcgctactcgctgacc
agccgacaaattccgatcagcggcaagcgcctgttcatgggccgcggctttcgctggacc
cgcctgcacacccagcgtctgctcgaagcacaagacccagcgctggcccgctacgtcaat
caatcggccgcccaccaatgggcgcggcggatggaacacctgctggagaaggccccgccc
gggctgtcactgctgcctcgcctgaccgcctgggacagtccactcaatcccgtgcgtccg
ctgccgcctgtgggtggctcgccattgctgcacggcgtcgagcctaaggaacaggaagcc
ggcttgccactgggcgagcgcgtcggccacaccctggtgctggggaccacgcgggtcggc
aagacgcgcctggccgaggtgtacatcacccaggacattcatcgaccaagccaggaggtg
gtgatcgtcttcgatcccaagggcgatgccgacctgctcaagcgcatgtacgtggaagcg
cggcgcgccggccgtgagcaagagttttacgttttccacctaggctggccggagatctcc
gcccgctacaacgccatcggccgcttcggccgcatttccgaagtcgccacccgcatcgct
ggccaactgagcggcgaaggcaactcggccgcatttcgcgagttcgcctggcgcttcgtc
aatatcatcgcccgggcgctgatcgagctcggccggcgccctgactacctgcagattcag
cggcacgtggtgaacatcgatgcgctgttcatcgagtacgctcagcacttcttcgcccgc
catgatccgcaggcctgggaagcaatcgtgcagatcgaaggtcgcctgaacgagaagaac
ataccgcggcacatgatcggtcgggaaaagcgcgtggtcgccatcgagcagtacctgact
gccaagcgcattttcgatccggtgatggacggcctgcgttcggcagtgcgctacgaccgc
acctatttcgacaagatcgtggcctcgctgctgccactgctggaaaaactcaccagcggc
aagaccgcgcaactgctcgcccccaactacaccgacctcgacgatccgcggccgatcttc
gactggctccaggtcatccgcaaacgcggcatcgtctacgttggcctggacgcgctgtcc
gacgccgaggtggcggctgccgtcggcaactcgatgtttgccgacctggtttcggtcgct
ggccatatctacaaacacggcattgatcacggcctgcctggatcctccagcgccgcggac
aaggtgccgatcaacctgcacgccgacgagttcaacgagctgatgggtgacgaattcatt
ccgctgatcaacaaaggtggtggcgccggaattcaagtcactgcctacacccagaccttg
agcgacatcgaggcgcgtatcggcaaccgggccaaggccggccaggtcatcggcaatttc
aatactctgcagatgctgcgggtgcgggaaaccgccaccgcagaactgctgaccaaccaa
ctgcccaaggtcaacgtgcagacccgcacgctggtctccagcgcgacagatactgccgat
cctgatgcccgcaccgacttcacctcttcctcgcaggatcgagtcaccaccacttcggta
ccactgattgaacccgcgcacatcatcgccttgcccaaggggcagatgttctctttccag
gagggaggacaattgtggaaggtgcgtatgcccctaccgaagccggccagcgacgatgcg
atgccggcggatctgcaggccctaaccgcacgcatgcgcgaatcctacaacgccaatgcg
gggagttggtggagcaccaccggcggtgctccgacggtcgatttcgatcccgagatgcct
ccacccggacgccggcactcctaa

DBGET integrated database retrieval system